BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_C20 (651 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 23 2.6 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 22 5.9 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 23.0 bits (47), Expect = 2.6 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +3 Query: 87 RNLSTAEKCSTTFHWSTKFCYIRNISVHNYWRQSNR-SYTLMWKAPVLANMDLS 245 RN+ K + T + + I+ IS + Y RQ+N + + K +AN DL+ Sbjct: 336 RNIEIVAKNNDTLQFISGIKIIKQISSNIYERQNNEYIWIVSNKYQKIANGDLN 389 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 103 LKNVLPHFIGARNFVTSE 156 +K LPHF+G+ V E Sbjct: 357 IKEELPHFVGSNKPVKDE 374 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,519 Number of Sequences: 438 Number of extensions: 3932 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -