BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_C18 (568 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 25 0.60 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 22 4.2 AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-mon... 21 5.6 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 21 5.6 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 21 5.6 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 24.6 bits (51), Expect = 0.60 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +2 Query: 143 RFCDFSLLIYLAAFVI 190 ++C+F +L YL+ FVI Sbjct: 320 KYCNFIILFYLSVFVI 335 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 21.8 bits (44), Expect = 4.2 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -1 Query: 196 LTNHECSKVYE*TKITKSSIL*TAGLLSQLEESSSVYRR 80 + H CS+ K+ + + T + QLEE S+ +R Sbjct: 273 MPKHACSEYCRVFKMLQEEDIFTPDRIPQLEEMSNFLKR 311 >AY052624-1|AAL15472.1| 212|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 212 Score = 21.4 bits (43), Expect = 5.6 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = +2 Query: 488 DRGLTTXLQQRWVTRCGNIY*SGFG 562 D L ++++W+ C ++ S FG Sbjct: 149 DELLFKCMKEKWIPLCNSVTFSNFG 173 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.4 bits (43), Expect = 5.6 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = +2 Query: 488 DRGLTTXLQQRWVTRCGNIY*SGFG 562 D L ++++W+ C ++ S FG Sbjct: 382 DELLFKCMKEKWIPLCNSVTFSNFG 406 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.4 bits (43), Expect = 5.6 Identities = 7/25 (28%), Positives = 14/25 (56%) Frame = +2 Query: 488 DRGLTTXLQQRWVTRCGNIY*SGFG 562 D L ++++W+ C ++ S FG Sbjct: 382 DELLFKCMKEKWIPLCNSVTFSNFG 406 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,230 Number of Sequences: 336 Number of extensions: 2032 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13995094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -