BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_C18 (568 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 25 1.7 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 23 5.3 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 23 6.9 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 9.2 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 9.2 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 25.0 bits (52), Expect = 1.7 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 465 IDLTAASAPPGTARRTTLSP 406 I+L A S PPG +RT L P Sbjct: 1604 IELIANSLPPGCFKRTHLEP 1623 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 23.4 bits (48), Expect = 5.3 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -3 Query: 269 FHCPTTVNKRNPTTKTSHALLLQDTHKSRM 180 FHCP + RN + H+ + D S M Sbjct: 953 FHCPRSDRIRNEMQQRCHSRVTMDNIVSEM 982 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 23.0 bits (47), Expect = 6.9 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = +2 Query: 221 WSLLLDFAYLRLWDSETCLRILTTKCSANFWGVRV 325 W LL YL LW E + + A W +R+ Sbjct: 20 WLQLLCLKYLGLWPPEDTDQATRNRYIAYGWALRI 54 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 22.6 bits (46), Expect = 9.2 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +1 Query: 418 CASCGPRWRRRCRQVNAVVPMER*SRP 498 C SCG + C A +P ER +P Sbjct: 1827 CRSCGQIFCAECSDYTAHLPEERLYQP 1853 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 22.6 bits (46), Expect = 9.2 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +1 Query: 418 CASCGPRWRRRCRQVNAVVPMER*SRP 498 C SCG + C A +P ER +P Sbjct: 1828 CRSCGQIFCAECSDYTAHLPEERLYQP 1854 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 542,171 Number of Sequences: 2352 Number of extensions: 9433 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53404389 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -