BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_C12 (342 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 26 0.12 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 26 0.12 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 3.5 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 20 8.1 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 20 8.1 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 25.8 bits (54), Expect = 0.12 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 126 FYCCKTV*RHQYAFAQINYI 185 FYC KT+ +H Y+ ++Y+ Sbjct: 20 FYCYKTIKQHIYSLISLSYL 39 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 25.8 bits (54), Expect = 0.12 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 126 FYCCKTV*RHQYAFAQINYI 185 FYC KT+ +H Y+ ++Y+ Sbjct: 20 FYCYKTIKQHIYSLISLSYL 39 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.0 bits (42), Expect = 3.5 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +1 Query: 148 DVISTPSHR*IIFLNKKINTFLHRIGVHFSFHL 246 D I+ P++ +IF + N HF FH+ Sbjct: 645 DTIAVPNNGYVIFRFRADNPGYWLFHCHFLFHI 677 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 19.8 bits (39), Expect = 8.1 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -1 Query: 144 QFYNNKSYXFXKHF 103 QFYN ++ F +H+ Sbjct: 400 QFYNFLNHNFDRHY 413 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 19.8 bits (39), Expect = 8.1 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -1 Query: 201 YFFIQKYNLSVRRRTDDVTQFYNNKSYXFXKHFF 100 YF I Y L++ + + +N+ Y F FF Sbjct: 43 YFIIAIYVLTILTSSVTLHVCFNSYMYAFTHIFF 76 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 53,613 Number of Sequences: 336 Number of extensions: 999 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6664455 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -