BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_C01 (648 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1245 - 32036929-32037042,32037152-32037208,32037299-320373... 28 5.6 11_01_0196 - 1547373-1549859 27 9.7 >04_04_1245 - 32036929-32037042,32037152-32037208,32037299-32037375, 32037479-32037563,32037615-32037684,32038007-32038068, 32038249-32038336,32038685-32038815,32039182-32039213, 32039377-32039489,32039741-32040045,32040148-32040233, 32040350-32040425,32041002-32041097 Length = 463 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 154 CCLCRRFFGAMFFQIIARRRSAKLANASHCTIALNC 261 C C RF G++ FQI R + ++S CT +C Sbjct: 92 CSYCFRFIGSIEFQIGRRLYWQSVGSSSDCTNRRHC 127 >11_01_0196 - 1547373-1549859 Length = 828 Score = 27.5 bits (58), Expect = 9.7 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 147 KVLLLVSSLFWSYVLSDHCTTPLGE-ASECVSLYDC 251 K++ L S FW Y L+D PLG+ A++C+ C Sbjct: 345 KLVALPHSDFWGYDLNDGEVMPLGDCANKCLDNCAC 380 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,938,392 Number of Sequences: 37544 Number of extensions: 325567 Number of successful extensions: 836 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 822 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 836 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -