BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_B21 (652 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0307 + 2414709-2414762,2415769-2415841,2416090-2416154,241... 52 5e-07 07_03_1757 + 29250163-29250349,29250612-29250813,29250898-292510... 29 2.4 06_03_0956 + 26296744-26297382,26297595-26297669,26298147-262983... 29 3.2 09_06_0231 + 21733151-21734905 28 7.4 >03_01_0307 + 2414709-2414762,2415769-2415841,2416090-2416154, 2416288-2416365,2416880-2416999,2418021-2418091, 2418808-2418900,2419242-2419311,2420236-2420436, 2421345-2421557,2422354-2422440,2422441-2422652, 2422901-2423042,2423424-2423592,2424050-2424126, 2424393-2424563,2425095-2425171,2425299-2425401, 2426066-2426185,2426301-2426444,2426826-2426975, 2427398-2427541,2427816-2427903,2428672-2428799, 2429329-2429533,2429843-2430015,2430174-2430392, 2430490-2430684 Length = 1213 Score = 51.6 bits (118), Expect = 5e-07 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 1/117 (0%) Frame = +3 Query: 276 VDVLDELTLPDEQPCIEAAPCSILYQANFDTNFEDRNGFITGIAKYIXEATVHAN-LNEL 452 + L +L DEQP ++ +L + TN + + E T N LN L Sbjct: 9 IAALSTFSLEDEQPDVQGLAV-LLSSERYATNSPIEYSDVAAYRLSLGEDTKAINQLNTL 67 Query: 453 LEXGNAHAVMLYTWRCCSRAIPQPRSNEQPDRVHIYERTVQVLAPEVDKLLQFMYFQ 623 ++ G A +LYT+R C +A+PQ + + + +Y T QVL E+ +L + +Q Sbjct: 68 IQEGKEMASLLYTYRSCVKALPQLPDSMKHSQADLYLETYQVLDLEMSRLREIQRWQ 124 >07_03_1757 + 29250163-29250349,29250612-29250813,29250898-29251008, 29251112-29251160,29251247-29251353,29251439-29251942, 29252486-29252614,29252865-29253161,29253274-29253720, 29253828-29253893,29254109-29254169,29254314-29254463, 29254555-29254689,29254791-29254818,29255430-29255479 Length = 840 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +2 Query: 422 SDRPRQLERAPGXRERPRCHAVHVALLQPC 511 S RP L P R R HA H+ALL C Sbjct: 16 SPRPPLLRLLPQPRRRRHAHAKHIALLTNC 45 >06_03_0956 + 26296744-26297382,26297595-26297669,26298147-26298341, 26298426-26298559,26298713-26298779,26298985-26299043, 26299204-26299321,26299613-26299726,26299855-26299986, 26300076-26300492,26300904-26300954,26301303-26301373, 26302067-26302151,26302258-26302410,26302522-26302596, 26302755-26302844,26303953-26304000,26304081-26304195, 26305356-26305459,26305582-26305692 Length = 950 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 216 IVQKAMSVSEKVSLSDALSNVDVLDELTLPDEQPCIEA 329 +VQ A + E V + L+NV+ LD L L C+ + Sbjct: 199 VVQAAHCIGEAVERENRLNNVEALDSLALYTTDRCVRS 236 >09_06_0231 + 21733151-21734905 Length = 584 Score = 27.9 bits (59), Expect = 7.4 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = -3 Query: 542 WLFIG--PGLRYGTAAATPRVQHDSVGVPXFQELVQVGVDGRFLYVLCDTGDE 390 WLF+ G +G AA V V ++ + G+ GRFL+ + GDE Sbjct: 186 WLFLFGVEGDGWGATAAATAVHALDVDAQRWRRVGADGLRGRFLFSVAGVGDE 238 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,266,830 Number of Sequences: 37544 Number of extensions: 317431 Number of successful extensions: 829 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 810 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 829 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -