BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_B21 (652 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 25 2.1 AY748846-1|AAV28192.1| 147|Anopheles gambiae cytochrome P450 pr... 23 6.3 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 25.0 bits (52), Expect = 2.1 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 285 LDELTLPDEQPCIEAAPCSILY 350 L EL DEQ CIE A C L+ Sbjct: 243 LPELYSYDEQSCIECAECRGLF 264 >AY748846-1|AAV28192.1| 147|Anopheles gambiae cytochrome P450 protein. Length = 147 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 389 VHHRYRKVHXGSDRPRQLERAPGXRERPRC 478 VH + GSDRP ++ R RC Sbjct: 76 VHQEIDSIFGGSDRPATMQDLTAMRLLERC 105 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 664,707 Number of Sequences: 2352 Number of extensions: 12596 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -