BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_B19 (540 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 29 0.13 AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CY... 29 0.13 DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasm... 25 1.2 AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 23 5.0 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 6.5 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 23 6.5 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 23 6.5 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 23 6.5 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 6.5 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 23 6.5 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 23 6.5 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 23 6.5 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 23 6.5 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 23 6.5 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 23 6.5 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 23 6.5 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 23 6.5 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 23 6.5 AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 pr... 23 8.7 AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease pr... 23 8.7 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 28.7 bits (61), Expect = 0.13 Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 4/81 (4%) Frame = +2 Query: 74 ATVLPW-LVTLAVSP-LRPPSAPYVRESMLDTHS--LWSNLANEMQHLDNMMKELSLKFP 241 +T+L W L LA++P ++ VRE +L H+ + + EM++LD ++ E K+P Sbjct: 310 STLLTWTLYELALNPEVQEKGRECVRE-ILQKHNGEMSYDAVVEMKYLDQILNESLRKYP 368 Query: 242 XIINEGRVEGDKYXISIHLPG 304 + RV Y H+PG Sbjct: 369 PVPVHLRVASKDY----HVPG 385 >AY062208-1|AAL58569.1| 503|Anopheles gambiae cytochrome P450 CYP6M1 protein. Length = 503 Score = 28.7 bits (61), Expect = 0.13 Identities = 18/74 (24%), Positives = 37/74 (50%), Gaps = 3/74 (4%) Frame = +2 Query: 74 ATVLPW-LVTLAVSPLRPPSAPYVRESMLDTHS--LWSNLANEMQHLDNMMKELSLKFPX 244 +T+L W L LA++P + +L H+ + + ++M++LD ++KE K+P Sbjct: 309 STLLTWTLYELALNPEVQEKGRQCVQEVLAKHNGEMTYDAIHDMKYLDQILKESLRKYPP 368 Query: 245 IINEGRVEGDKYXI 286 + R+ Y + Sbjct: 369 VPMHFRMTAQDYRV 382 >DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasmic carbonic anhydrase protein. Length = 276 Score = 25.4 bits (53), Expect = 1.2 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +3 Query: 120 DPLQLLTFGKACWTHIRFGPTLP-TKCNTW 206 DP +LL GKA WT++ T P ++ TW Sbjct: 182 DPARLLPEGKAYWTYLGSLTTPPCSESVTW 211 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 23.4 bits (48), Expect = 5.0 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 Query: 191 EMQHLDNMMKELSLKFPXIINEGRVEGDKYXI 286 EM +LD ++KE K+P + R +Y + Sbjct: 292 EMNYLDQILKESLRKYPPVPVHFRETSKEYQV 323 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 6.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 279 YLSPSTRPSFIMXG 238 YL P TRPS ++ G Sbjct: 1157 YLQPKTRPSIMLPG 1170 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 87 HGSSHWPYHHY 119 HG SH +HHY Sbjct: 222 HGPSHLSHHHY 232 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 87 HGSSHWPYHHY 119 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 87 HGSSHWPYHHY 119 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 87 HGSSHWPYHHY 119 HG SH +HHY Sbjct: 224 HGPSHLSHHHY 234 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 87 HGSSHWPYHHY 119 HG SH +HHY Sbjct: 229 HGPSHLSHHHY 239 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 87 HGSSHWPYHHY 119 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 87 HGSSHWPYHHY 119 HG SH +HHY Sbjct: 229 HGPSHLSHHHY 239 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 87 HGSSHWPYHHY 119 HG SH +HHY Sbjct: 253 HGPSHLSHHHY 263 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 87 HGSSHWPYHHY 119 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 87 HGSSHWPYHHY 119 HG SH +HHY Sbjct: 222 HGPSHLSHHHY 232 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 87 HGSSHWPYHHY 119 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 87 HGSSHWPYHHY 119 HG SH +HHY Sbjct: 229 HGPSHLSHHHY 239 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 6.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 87 HGSSHWPYHHY 119 HG SH +HHY Sbjct: 221 HGPSHLSHHHY 231 >AY081778-1|AAL91655.1| 507|Anopheles gambiae cytochrome P450 protein. Length = 507 Score = 22.6 bits (46), Expect = 8.7 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +2 Query: 179 NLANEMQHLDNMMKELSLKFPXIINEGRVEGDKYXI 286 ++ +Q+LD+++ E K+P I + RV Y + Sbjct: 355 DMVMNVQYLDSVINETLRKYPPIESLSRVPMRDYTV 390 >AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease protein. Length = 375 Score = 22.6 bits (46), Expect = 8.7 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 39 VLCGLLAAVSAAPQYYHGSSHWP 107 V CGLL + A HG H P Sbjct: 7 VACGLLCLLVIAIDQGHGQEHKP 29 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 527,575 Number of Sequences: 2352 Number of extensions: 9739 Number of successful extensions: 43 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 50320221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -