BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_B17 (653 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 23 1.7 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 22 5.1 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 21 8.9 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 23.4 bits (48), Expect = 1.7 Identities = 23/75 (30%), Positives = 34/75 (45%) Frame = +1 Query: 421 EEYPFAERQKFLNQYPHFKTNIQGLNIHFMRITPKVPKDVEIVPLLCYSTDGRAPSGSST 600 E+ AER++ L YP +K ++ G + P+DVE+V TD + + S Sbjct: 53 EQLFLAERERGLKYYPIYKLDVCGNG----GVNLLNPEDVELV-----LTDTKQNTKSFI 103 Query: 601 KPFLISQLSAKTXTS 645 FL S L TS Sbjct: 104 YHFLHSWLGTGLLTS 118 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -1 Query: 461 WLRNFCLSANGYSSAQYLSQLSNCFELNPYLKP 363 W + CL + ++ +N +PYL P Sbjct: 84 WFKIHCLLQEQQQAGANMAAAANLLRPHPYLSP 116 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.0 bits (42), Expect = 8.9 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 395 WTVGSNIGQKNTHSLKG 445 W V + QKNTH KG Sbjct: 311 WKVVWDDTQKNTHMYKG 327 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,709 Number of Sequences: 336 Number of extensions: 3440 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -