BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_B15 (652 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g12210.2 68416.m01524 expressed protein 80 1e-15 At3g12210.1 68416.m01523 expressed protein 71 9e-13 At1g61980.1 68414.m06991 mitochondrial transcription termination... 33 0.16 At5g20420.1 68418.m02428 SNF2 domain-containing protein / helica... 31 0.50 At4g32820.1 68417.m04668 expressed protein ; expression supporte... 31 0.66 At1g75700.1 68414.m08794 abscisic acid-responsive HVA22 family p... 31 0.88 At5g26020.1 68418.m03096 hypothetical protein 30 1.2 At1g61990.1 68414.m06992 mitochondrial transcription termination... 30 1.5 At1g61960.1 68414.m06989 mitochondrial transcription termination... 30 1.5 At1g62110.1 68414.m07008 mitochondrial transcription termination... 29 3.5 At3g56100.1 68416.m06235 leucine-rich repeat transmembrane prote... 28 6.2 At1g61970.1 68414.m06990 mitochondrial transcription termination... 28 6.2 At1g62150.1 68414.m07011 mitochondrial transcription termination... 27 8.2 At1g62085.1 68414.m07006 mitochondrial transcription termination... 27 8.2 >At3g12210.2 68416.m01524 expressed protein Length = 209 Score = 79.8 bits (188), Expect = 1e-15 Identities = 43/137 (31%), Positives = 72/137 (52%) Frame = +1 Query: 217 ELIKLDNWYQNELPKKIKSRGKDAHMIHEELVQLMKWKQAXGKFYPQLSYLIKVNTPRAV 396 EL+ LD +Y+ +LP + R + ++ EL QLMKWK + GK+ P+L + V Sbjct: 31 ELVSLDQFYRIKLPCLLHDRDPNPYLTTSELSQLMKWKLSRGKWRPRLLDFVSSLDDSVV 90 Query: 397 MQETKKAFRKLPNIESAMTALSNLKGVGXXXXXXXXXXXXXXXXXFMADECVQAIPEMEG 576 ++KAF+ LP+I A+ L+ LKGVG FM+DE ++ + Sbjct: 91 KSASEKAFKSLPDISKAVKELTVLKGVGAATASAVLAAYAPDIAPFMSDEAME-VALGNS 149 Query: 577 SDYTAREYLNFVSHIRN 627 DY+ ++YL F + +++ Sbjct: 150 KDYSLKQYLLFATKLQD 166 >At3g12210.1 68416.m01523 expressed protein Length = 155 Score = 70.5 bits (165), Expect = 9e-13 Identities = 38/110 (34%), Positives = 57/110 (51%) Frame = +1 Query: 217 ELIKLDNWYQNELPKKIKSRGKDAHMIHEELVQLMKWKQAXGKFYPQLSYLIKVNTPRAV 396 EL+ LD +Y+ +LP + R + ++ EL QLMKWK + GK+ P+L + V Sbjct: 31 ELVSLDQFYRIKLPCLLHDRDPNPYLTTSELSQLMKWKLSRGKWRPRLLDFVSSLDDSVV 90 Query: 397 MQETKKAFRKLPNIESAMTALSNLKGVGXXXXXXXXXXXXXXXXXFMADE 546 ++KAF+ LP+I A+ L+ LKGVG FM+DE Sbjct: 91 KSASEKAFKSLPDISKAVKELTVLKGVGAATASAVLAAYAPDIAPFMSDE 140 >At1g61980.1 68414.m06991 mitochondrial transcription termination factor-related / mTERF-related contains Pfam profile PF02536: mTERF Length = 418 Score = 33.1 bits (72), Expect = 0.16 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +1 Query: 67 VVHLERSQLATAKDTSTFF-LEANAKEFDSVLKLYPQAIKLKAERKTKRPDELIKLDNW 240 + H E+ L T + TF L + EF ++K +PQ I L AE K+ + L+K NW Sbjct: 285 LTHSEKKILNTIE---TFLGLGFSRDEFSVLIKRFPQGIGLSAEMVKKKTEFLVKKMNW 340 >At5g20420.1 68418.m02428 SNF2 domain-containing protein / helicase domain-containing protein low similarity to SP|Q9U7E0 Transcriptional regulator ATRX homolog {Caenorhabditis elegans}; contains PFam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 1261 Score = 31.5 bits (68), Expect = 0.50 Identities = 17/61 (27%), Positives = 35/61 (57%), Gaps = 5/61 (8%) Frame = +1 Query: 301 EELVQLMKWKQAXGKFYPQLSYLIKVNTPRAVM-----QETKKAFRKLPNIESAMTALSN 465 E+ LMK + + GKF P LS+L +T ++++ +TK ++ + + E + + LS+ Sbjct: 169 EDCTSLMKTRLSLGKFLPDLSWLTVTSTLKSIVFQIRTVQTKMVYQIVTDEEGSSSTLSS 228 Query: 466 L 468 + Sbjct: 229 M 229 >At4g32820.1 68417.m04668 expressed protein ; expression supported by MPSS Length = 1817 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +1 Query: 73 HLERSQLATAKDTSTFFLEANAKEFDSVLKLYPQAIKLKAE 195 HL + K+ +T FLE + +++ L Y QAI L A+ Sbjct: 75 HLHHLRFLALKNLATVFLELGSSHYENALNCYLQAIDLDAK 115 >At1g75700.1 68414.m08794 abscisic acid-responsive HVA22 family protein weak similarity to SP|Q00765 Polyposis locus protein 1 (TB2 protein) {Homo sapiens}; contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 166 Score = 30.7 bits (66), Expect = 0.88 Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 3/61 (4%) Frame = +1 Query: 241 YQNELPK---KIKSRGKDAHMIHEELVQLMKWKQAXGKFYPQLSYLIKVNTPRAVMQETK 411 ++NE+ + K+K+R KD MI+ + Q KF+ L Y+ + +TP++ +E K Sbjct: 90 HENEIDRNLVKVKTRAKDMAMIYLQKAI----NQGQTKFFEILQYITEQSTPKSKAEEKK 145 Query: 412 K 414 + Sbjct: 146 E 146 >At5g26020.1 68418.m03096 hypothetical protein Length = 241 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 402 RDEKGLPQTAQYRIRDDRSKQSQRRGNGHSIS 497 RDE G P T + ++ + + ++QRRG G S Sbjct: 106 RDETGTPMTQRKKVCEPEASKTQRRGKGDEAS 137 >At1g61990.1 68414.m06992 mitochondrial transcription termination factor-related / mTERF-related contains Pfam profile PF02536: mTERF Length = 414 Score = 29.9 bits (64), Expect = 1.5 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +1 Query: 76 LERSQLATAKDTSTFF-LEANAKEFDSVLKLYPQAIKLKAERKTKRPDELIKLDNWYQNE 252 L+ S+ K TF L + EF ++K YP I+ E K+ + L+K W +N Sbjct: 278 LKVSKKKILKSAETFLDLGYSRAEFLMMVKRYPPCIEYSVESVKKKNEFLVKKMKWPRNA 337 Query: 253 L 255 L Sbjct: 338 L 338 >At1g61960.1 68414.m06989 mitochondrial transcription termination factor-related / mTERF-related contains Pfam profile PF02536: mTERF Length = 457 Score = 29.9 bits (64), Expect = 1.5 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 142 EFDSVLKLYPQAIKLKAERKTKRPDELIKLDNW 240 EF ++K YPQ I AE K+ + ++K NW Sbjct: 344 EFAMMVKRYPQCIDYTAETVKKKTEFIVKNMNW 376 >At1g62110.1 68414.m07008 mitochondrial transcription termination factor family protein / mTERF family protein contains Pfam profile PF02536: mTERF Length = 462 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 142 EFDSVLKLYPQAIKLKAERKTKRPDELIKLDNW 240 EF +++K +PQ + L AE K+ + ++K NW Sbjct: 345 EFITMVKRFPQCLILSAETVKKKIEFVVKKMNW 377 >At3g56100.1 68416.m06235 leucine-rich repeat transmembrane protein kinase, putative hypothetical proteins - Arabidopsis thaliana Length = 719 Score = 27.9 bits (59), Expect = 6.2 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 2/61 (3%) Frame = +1 Query: 175 AIKLKAER--KTKRPDELIKLDNWYQNELPKKIKSRGKDAHMIHEELVQLMKWKQAXGKF 348 A+K ER K K+ ++L+ D + L + +RG D H+ + L+K A G F Sbjct: 477 AVKRLRERSPKVKKREKLVVFDYMSRGSLATFLHARGPDVHINWPTRMSLIK-GMARGLF 535 Query: 349 Y 351 Y Sbjct: 536 Y 536 >At1g61970.1 68414.m06990 mitochondrial transcription termination factor-related / mTERF-related contains Pfam profile PF02536: mTERF Length = 418 Score = 27.9 bits (59), Expect = 6.2 Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = +1 Query: 70 VHLERSQLATAKDTSTFF-LEANAKEFDSVLKLYPQAIKLKAERKTKRPDELIKLDNW 240 + L S+ TF L + EF ++K +P I L E K+ + L+K NW Sbjct: 283 ISLRVSEKKMLDSIETFLGLGFSRDEFAKMVKHFPPCIGLSTETVKKKTEFLVKKMNW 340 >At1g62150.1 68414.m07011 mitochondrial transcription termination factor-related / mTERF-related contains Pfam profile PF02536: mTERF Length = 463 Score = 27.5 bits (58), Expect = 8.2 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +1 Query: 76 LERSQLATAKDTSTFF-LEANAKEFDSVLKLYPQAIKLKAERKTKRPDELIKLDNW 240 L S+ TF L + EF ++K PQ I AE K+ + ++K NW Sbjct: 328 LRASEQQILNSMETFIGLGFSRDEFVMMVKCLPQCIGYSAEMVKKKTEFVVKKMNW 383 >At1g62085.1 68414.m07006 mitochondrial transcription termination factor family protein / mTERF family protein contains Pfam profile PF02536: mTERF Length = 461 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 142 EFDSVLKLYPQAIKLKAERKTKRPDELIKLDNW 240 E + K +PQ + L AE K+ + L+K NW Sbjct: 348 EVAMIAKRFPQCLILSAETVKKKTEFLVKKMNW 380 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,933,930 Number of Sequences: 28952 Number of extensions: 276316 Number of successful extensions: 724 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 723 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -