BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_B12 (655 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0628 + 21357876-21359921 30 1.4 02_05_0942 + 32970537-32970581,32971059-32971113,32971300-329714... 29 3.2 10_07_0152 + 13439178-13439517,13440072-13440229,13440431-134404... 28 5.6 04_04_1551 - 34348110-34348225,34348468-34348606,34348658-343488... 28 7.5 02_05_0895 - 32593155-32593190,32594228-32594279,32594544-325945... 27 9.9 01_01_0278 - 2281536-2281977,2282523-2282926 27 9.9 >12_02_0628 + 21357876-21359921 Length = 681 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = +1 Query: 463 LPDMTDFKYIGTETMQDADTAKWQMVQPVGDKLNKYTMWVKYXKTLKGDSVPIPVRYEM 639 L T KY+ +A+ A+WQM Q V D + K+ + + + V +P R ++ Sbjct: 362 LEGYTTCKYLNVVWDNEANAARWQMTQ-VSDSFPSEEEFKKWLQVAEKNGVRVPTRQDV 419 >02_05_0942 + 32970537-32970581,32971059-32971113,32971300-32971417, 32971567-32971615,32971637-32971723,32971890-32971970, 32972074-32972181,32972432-32972503,32973218-32973250 Length = 215 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/52 (23%), Positives = 27/52 (51%) Frame = +1 Query: 232 YAELHEPFYAWYDSKNSKSRIDYYGGMVKTYQFTSAVYPPYGTSIKIAPVTT 387 + E P +Y++K+ +ID + + ++ A++ PY + ++ VTT Sbjct: 162 FVESSLPVIEYYNAKDKVKKIDAAKPIPEVFEDVKAIFAPYAPNALLSGVTT 213 >10_07_0152 + 13439178-13439517,13440072-13440229,13440431-13440477, 13441115-13441178,13441600-13442237,13442328-13442562 Length = 493 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +1 Query: 169 DKGSPPQWSPVYTVKGLLNIPYAELHEP 252 D GS +W P+ G +N P LH P Sbjct: 391 DSGSTSEWRPLIKKYGYVNCPTVRLHIP 418 >04_04_1551 - 34348110-34348225,34348468-34348606,34348658-34348896, 34349042-34349140,34349207-34350188,34350737-34350832, 34350936-34351064,34351253-34351332,34351420-34351661, 34351743-34352692 Length = 1023 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 89 DLRRSAVESCYSLRCCVFSWPSHLDMSIK 175 D+ S V+ C + +C V WPSHL I+ Sbjct: 356 DIYDSGVDDCSNPKCYVM-WPSHLSTHIR 383 >02_05_0895 - 32593155-32593190,32594228-32594279,32594544-32594584, 32594795-32594906,32595195-32595268,32595349-32595587, 32595710-32596678,32596725-32596878,32596957-32597244, 32597393-32597534,32598679-32598752,32598870-32598890 Length = 733 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = +1 Query: 217 LLNIPYAELHEPFYAWYDSKNSKSRIDYYGGMVKTYQFTSAVYPPYGTSIKIAPVT 384 +L + L PF+ W ++ SR+ Y G M+ + F A + S+KI T Sbjct: 426 MLKATASRLFGPFFDWIETWEMISRLKYLGTMLFLHNFQQA----FTWSLKIVTAT 477 >01_01_0278 - 2281536-2281977,2282523-2282926 Length = 281 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/50 (30%), Positives = 20/50 (40%) Frame = +1 Query: 421 VNSTQDQLQDIQSVLPDMTDFKYIGTETMQDADTAKWQMVQPVGDKLNKY 570 +N +D D+Q + M F G A T +W VGD N Y Sbjct: 54 MNHFRDLELDVQQIENGMVPFPVYGAAAAGGAFTLQWDGAHGVGDFRNAY 103 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,778,704 Number of Sequences: 37544 Number of extensions: 375443 Number of successful extensions: 916 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 893 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 916 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -