BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_A23 (631 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57953| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.021 SB_50916| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_37923| Best HMM Match : rve (HMM E-Value=1.2e-12) 30 1.3 SB_37261| Best HMM Match : rve (HMM E-Value=2.1e-08) 30 1.3 SB_19007| Best HMM Match : rve (HMM E-Value=2e-12) 30 1.3 SB_56129| Best HMM Match : rve (HMM E-Value=2.3e-12) 30 1.3 SB_52583| Best HMM Match : rve (HMM E-Value=0.00025) 30 1.3 SB_43345| Best HMM Match : rve (HMM E-Value=2.8e-11) 30 1.3 SB_15661| Best HMM Match : rve (HMM E-Value=3e-10) 30 1.3 SB_25625| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_49906| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_47583| Best HMM Match : SAP (HMM E-Value=8.9e-08) 28 5.4 SB_47249| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_43372| Best HMM Match : DUF1495 (HMM E-Value=5.3) 28 5.4 SB_32949| Best HMM Match : SAP (HMM E-Value=1) 28 5.4 SB_11984| Best HMM Match : rve (HMM E-Value=2.3) 28 5.4 SB_31924| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00073) 28 7.2 SB_55795| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-08) 27 9.5 >SB_57953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 712 Score = 36.3 bits (80), Expect = 0.021 Identities = 19/54 (35%), Positives = 28/54 (51%) Frame = +2 Query: 347 LNEELSYCXGLGVPAIMISIHGRESNNLARILQTYYETSHHPSLIWACVPMLCS 508 L +E++Y LG+P++M+ + NLA + SH L W VPM CS Sbjct: 118 LMQEVNYAIHLGLPSVMLELGNYNIINLAHYVNDILINSHVQQL-WIKVPMRCS 170 >SB_50916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1681 Score = 31.5 bits (68), Expect = 0.58 Identities = 26/98 (26%), Positives = 41/98 (41%) Frame = +2 Query: 305 IHLQPTVRQRHXDYLNEELSYCXGLGVPAIMISIHGRESNNLARILQTYYETSHHPSLIW 484 +HL+ T +LN +C G PA+++S + + + A+ L Y+ P + Sbjct: 813 LHLELTEDLSTRSFLNCLRRFCARRGTPALIVSDNAKTFKSAAKFLNELYD---QPDI-- 867 Query: 485 ACVPMLCSTTYXXCTEDDEQXKAWNEPWYWWSKFHERL 598 TY C E+ Q K E WW F ER+ Sbjct: 868 --------RTY--CEENRIQWKFNRERAPWWGGFFERI 895 >SB_37923| Best HMM Match : rve (HMM E-Value=1.2e-12) Length = 283 Score = 30.3 bits (65), Expect = 1.3 Identities = 26/98 (26%), Positives = 41/98 (41%) Frame = +2 Query: 305 IHLQPTVRQRHXDYLNEELSYCXGLGVPAIMISIHGRESNNLARILQTYYETSHHPSLIW 484 +HL+ T +LN +C G PA+++S + + + A+ L Y+ P + Sbjct: 58 LHLELTEDLSTRSFLNCLRRFCARRGTPALIVSDNAKTFKSAAKFLNELYD---QPDI-- 112 Query: 485 ACVPMLCSTTYXXCTEDDEQXKAWNEPWYWWSKFHERL 598 TY C E+ Q K E WW F ER+ Sbjct: 113 --------RTY--CEENRIQWKFNLERAPWWGGFFERM 140 >SB_37261| Best HMM Match : rve (HMM E-Value=2.1e-08) Length = 757 Score = 30.3 bits (65), Expect = 1.3 Identities = 26/98 (26%), Positives = 41/98 (41%) Frame = +2 Query: 305 IHLQPTVRQRHXDYLNEELSYCXGLGVPAIMISIHGRESNNLARILQTYYETSHHPSLIW 484 +HL+ T +LN +C G PA+++S + + + A+ L Y+ P + Sbjct: 404 LHLELTEDLSTRSFLNCLRRFCARRGTPALIVSDNAKTFKSAAKFLNELYD---QPDI-- 458 Query: 485 ACVPMLCSTTYXXCTEDDEQXKAWNEPWYWWSKFHERL 598 TY C E+ Q K E WW F ER+ Sbjct: 459 --------RTY--CEENRIQWKFNLERAPWWGGFFERM 486 >SB_19007| Best HMM Match : rve (HMM E-Value=2e-12) Length = 539 Score = 30.3 bits (65), Expect = 1.3 Identities = 26/98 (26%), Positives = 41/98 (41%) Frame = +2 Query: 305 IHLQPTVRQRHXDYLNEELSYCXGLGVPAIMISIHGRESNNLARILQTYYETSHHPSLIW 484 +HL+ T +LN +C G PA+++S + + + A+ L Y+ P + Sbjct: 269 LHLELTEDLSTRSFLNCLRRFCARRGTPALIVSDNAKTFKSAAKFLNELYD---QPDI-- 323 Query: 485 ACVPMLCSTTYXXCTEDDEQXKAWNEPWYWWSKFHERL 598 TY C E+ Q K E WW F ER+ Sbjct: 324 --------RTY--CEENRIQWKFNLERAPWWGGFFERM 351 >SB_56129| Best HMM Match : rve (HMM E-Value=2.3e-12) Length = 308 Score = 30.3 bits (65), Expect = 1.3 Identities = 26/98 (26%), Positives = 41/98 (41%) Frame = +2 Query: 305 IHLQPTVRQRHXDYLNEELSYCXGLGVPAIMISIHGRESNNLARILQTYYETSHHPSLIW 484 +HL+ T +LN +C G PA+++S + + + A+ L Y+ P + Sbjct: 151 LHLELTEDLSTRSFLNCLRRFCARRGTPALIVSDNAKTFKSAAKFLNELYD---QPDI-- 205 Query: 485 ACVPMLCSTTYXXCTEDDEQXKAWNEPWYWWSKFHERL 598 TY C E+ Q K E WW F ER+ Sbjct: 206 --------RTY--CEENRIQWKFNLERAPWWGGFFERM 233 >SB_52583| Best HMM Match : rve (HMM E-Value=0.00025) Length = 287 Score = 30.3 bits (65), Expect = 1.3 Identities = 26/98 (26%), Positives = 41/98 (41%) Frame = +2 Query: 305 IHLQPTVRQRHXDYLNEELSYCXGLGVPAIMISIHGRESNNLARILQTYYETSHHPSLIW 484 +HL+ T +LN +C G PA+++S + + + A+ L Y+ P + Sbjct: 17 LHLELTEDLSTRSFLNCLRRFCARRGTPALIVSDNAKTFKSAAKFLNELYD---QPDI-- 71 Query: 485 ACVPMLCSTTYXXCTEDDEQXKAWNEPWYWWSKFHERL 598 TY C E+ Q K E WW F ER+ Sbjct: 72 --------RTY--CEENRIQWKFNLERAPWWGGFFERM 99 >SB_43345| Best HMM Match : rve (HMM E-Value=2.8e-11) Length = 382 Score = 30.3 bits (65), Expect = 1.3 Identities = 26/98 (26%), Positives = 41/98 (41%) Frame = +2 Query: 305 IHLQPTVRQRHXDYLNEELSYCXGLGVPAIMISIHGRESNNLARILQTYYETSHHPSLIW 484 +HL+ T +LN +C G PA+++S + + + A+ L Y+ P + Sbjct: 257 LHLELTEDLSTRSFLNCLRRFCARRGTPALIVSDNAKTFKSAAKFLNELYD---QPDI-- 311 Query: 485 ACVPMLCSTTYXXCTEDDEQXKAWNEPWYWWSKFHERL 598 TY C E+ Q K E WW F ER+ Sbjct: 312 --------RTY--CEENRIQWKFNLERAPWWGGFFERM 339 >SB_15661| Best HMM Match : rve (HMM E-Value=3e-10) Length = 375 Score = 30.3 bits (65), Expect = 1.3 Identities = 26/98 (26%), Positives = 41/98 (41%) Frame = +2 Query: 305 IHLQPTVRQRHXDYLNEELSYCXGLGVPAIMISIHGRESNNLARILQTYYETSHHPSLIW 484 +HL+ T +LN +C G PA+++S + + + A+ L Y+ P + Sbjct: 105 LHLELTEDLSTRSFLNCLRRFCARRGTPALIVSDNAKTFKSAAKFLNELYD---QPDI-- 159 Query: 485 ACVPMLCSTTYXXCTEDDEQXKAWNEPWYWWSKFHERL 598 TY C E+ Q K E WW F ER+ Sbjct: 160 --------RTY--CEENRIQWKFNLERAPWWGGFFERM 187 >SB_25625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 29.1 bits (62), Expect = 3.1 Identities = 12/52 (23%), Positives = 30/52 (57%) Frame = +1 Query: 52 IKKMAQQEISCGYEYIITADLQTCLTEALQCSYSFIVSPIIHPRFRRQSTNA 207 +K + + + +++TADL++ LTE+ S++++++ + P T+A Sbjct: 41 LKSALTESHTDSFTWLLTADLKSALTESHTDSFTWLLTADLKPALTESHTDA 92 >SB_49906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 67 QQEISCGYEYIITADLQTCLTEALQCSYSFIVSP 168 QQ+I+ GYE + A L +C T+ +Q + ++ P Sbjct: 8 QQQITTGYESVAFAILSSCRTQFMQITDRILLYP 41 >SB_47583| Best HMM Match : SAP (HMM E-Value=8.9e-08) Length = 407 Score = 28.3 bits (60), Expect = 5.4 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 406 TREREQQFSQNSPNLL*NEPPSVSNMGMCTYAM 504 T+ +QQ S SP+ + PPS S G T AM Sbjct: 114 TKSVKQQSSMFSPSAMLCSPPSTSTQGQTTLAM 146 >SB_47249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +2 Query: 281 SYLRTLTLIHLQPTVRQRHXDYLN--EELSY 367 SYLR LT IH+ P DY+N EE Y Sbjct: 54 SYLRALTPIHVLPNDSDYSMDYINVPEEFRY 84 >SB_43372| Best HMM Match : DUF1495 (HMM E-Value=5.3) Length = 269 Score = 28.3 bits (60), Expect = 5.4 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +2 Query: 281 SYLRTLTLIHLQPTVRQRHXDYLN--EELSY 367 SYLR LT IH+ P DY+N EE Y Sbjct: 8 SYLRALTPIHVLPNDSDYSMDYINVPEEFRY 38 >SB_32949| Best HMM Match : SAP (HMM E-Value=1) Length = 269 Score = 28.3 bits (60), Expect = 5.4 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 406 TREREQQFSQNSPNLL*NEPPSVSNMGMCTYAM 504 T+ +QQ S SP+ + PPS S G T AM Sbjct: 192 TKSVKQQSSMFSPSAMLCSPPSTSTQGQTTLAM 224 >SB_11984| Best HMM Match : rve (HMM E-Value=2.3) Length = 212 Score = 28.3 bits (60), Expect = 5.4 Identities = 13/51 (25%), Positives = 25/51 (49%) Frame = +2 Query: 305 IHLQPTVRQRHXDYLNEELSYCXGLGVPAIMISIHGRESNNLARILQTYYE 457 +HL+ T +LN +C G PA+++S + + + A+ L Y+ Sbjct: 17 LHLELTEDLSTRSFLNCLRRFCARRGTPALIVSDNAKTFKSAAKFLNELYD 67 >SB_31924| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00073) Length = 498 Score = 27.9 bits (59), Expect = 7.2 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 554 WNEPWYWWSKFHERLDWDKRV 616 WN+PWY W K + D DK V Sbjct: 26 WNKPWYQWDK--KENDADKTV 44 >SB_55795| Best HMM Match : 7tm_1 (HMM E-Value=3.9e-08) Length = 363 Score = 27.5 bits (58), Expect = 9.5 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -2 Query: 219 TIFTGICGLPTKTWVNNGRNYK*ITALKCFC 127 T + C +PT ++N+ RN + L C+C Sbjct: 213 TFLSYFCFVPTAVFINDFRNTEAYVVLACYC 243 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,187,807 Number of Sequences: 59808 Number of extensions: 386082 Number of successful extensions: 703 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 647 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 694 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -