BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_A21 (646 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.2 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 23 2.8 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 8.7 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 8.7 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 8.7 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.2 Identities = 6/12 (50%), Positives = 11/12 (91%) Frame = +1 Query: 4 SC*IKNGEPCWF 39 +C ++NG+PC+F Sbjct: 426 ACGLRNGDPCFF 437 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.2 Identities = 6/12 (50%), Positives = 11/12 (91%) Frame = +1 Query: 4 SC*IKNGEPCWF 39 +C ++NG+PC+F Sbjct: 426 ACGLRNGDPCFF 437 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.2 Identities = 6/12 (50%), Positives = 11/12 (91%) Frame = +1 Query: 4 SC*IKNGEPCWF 39 +C ++NG+PC+F Sbjct: 426 ACGLRNGDPCFF 437 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.2 Identities = 6/12 (50%), Positives = 11/12 (91%) Frame = +1 Query: 4 SC*IKNGEPCWF 39 +C ++NG+PC+F Sbjct: 426 ACGLRNGDPCFF 437 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 22.6 bits (46), Expect = 2.8 Identities = 6/25 (24%), Positives = 15/25 (60%) Frame = -3 Query: 122 VFHYFHHCQSIALNIVGSSLHFQER 48 +++ H CQ+++ ++G+ L R Sbjct: 265 LYYLSHVCQNVSTEVIGNILRLMHR 289 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -2 Query: 444 ESSG*FLCIVNHN 406 E SG +LC+VN++ Sbjct: 300 EDSGKYLCVVNNS 312 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/36 (22%), Positives = 17/36 (47%) Frame = -2 Query: 291 DSSKPPHHVQLVFLXIHGVVMLWKWEAVGNLQTVLN 184 + + P H + +F+ H LW + + L ++ N Sbjct: 42 EQNNQPVHDEHLFIVTHQAYELWFKQIIYELDSIRN 77 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.0 bits (42), Expect = 8.7 Identities = 8/36 (22%), Positives = 17/36 (47%) Frame = -2 Query: 291 DSSKPPHHVQLVFLXIHGVVMLWKWEAVGNLQTVLN 184 + + P H + +F+ H LW + + L ++ N Sbjct: 42 EQNNQPVHDEHLFIVTHQAYELWFKQIIYELDSIRN 77 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,012 Number of Sequences: 336 Number of extensions: 2413 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16552695 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -