BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_A14 (553 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0120 + 31804301-31804412,31804525-31804631,31804714-318047... 31 0.46 10_02_0174 - 6202334-6204922 30 1.4 09_04_0436 - 17558603-17559265,17559322-17559384 30 1.4 03_06_0108 + 31708713-31709079,31709258-31709822,31709933-317100... 27 10.0 >03_06_0120 + 31804301-31804412,31804525-31804631,31804714-31804756, 31806069-31806187 Length = 126 Score = 31.5 bits (68), Expect = 0.46 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = +2 Query: 149 WKRMSFFVAFPAIALGMLNAYLAHQEEHHERPPFVPYEYMRIRTKRFPW 295 W+++++ L N H H + PP Y Y+ IR K FPW Sbjct: 43 WEKITYAGIVTCTLLAAYNLSKGHP--HFDEPP--AYPYLHIRNKEFPW 87 >10_02_0174 - 6202334-6204922 Length = 862 Score = 29.9 bits (64), Expect = 1.4 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Frame = +2 Query: 215 AHQEEHHERPPFVPYEYMRIRTKRFPW-GDGQ-KSLFHNPHVNALPSGYEDDH*ITII 382 A E H+ Y M + W GDG S+ +NPH+ A GY+ D ++II Sbjct: 346 ASSESKHKPKWLDDYSAMITQAVLTGWFGDGMANSVMYNPHLVARQFGYDQDFPVSII 403 >09_04_0436 - 17558603-17559265,17559322-17559384 Length = 241 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +1 Query: 91 ARAIFACCYCWWAWRWLH-IMEKDVLL 168 AR A C+C W WRWL + EK+ L Sbjct: 95 ARRGSARCWCAWRWRWLQWLREKEAEL 121 >03_06_0108 + 31708713-31709079,31709258-31709822,31709933-31710015, 31710231-31710319,31710486-31710559,31710654-31710704, 31710807-31710883,31711454-31712031,31712388-31712555, 31713364-31713417,31713456-31713467,31713554-31713715 Length = 759 Score = 27.1 bits (57), Expect = 10.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -3 Query: 371 FSGHLHNRWEGHSHEGCGKGTSVHHPMGNALYECACI 261 + GH H+ +GH+ +G G HH G +CA I Sbjct: 153 YGGHGHH--QGHAQDGGAVGGDPHHG-GGGFLQCAVI 186 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,189,881 Number of Sequences: 37544 Number of extensions: 264584 Number of successful extensions: 610 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 609 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1245816180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -