BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_A10 (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. 27 0.68 DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 23 6.3 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 23 8.3 >AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. Length = 194 Score = 26.6 bits (56), Expect = 0.68 Identities = 18/63 (28%), Positives = 26/63 (41%), Gaps = 3/63 (4%) Frame = +1 Query: 469 NQPKTDTSNHHHIFVG---DLSPEIETNILREAFAPFGEISNCRIVRDPQTLKSKGLCFC 639 N P +NHH +FVG + E +NI F + C VR L + C Sbjct: 2 NIPARHGANHHELFVGIGRSAADESNSNI-ATVFHRQSRVEMCNSVR--TALAASNCCSI 58 Query: 640 IIC 648 ++C Sbjct: 59 VLC 61 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 23.4 bits (48), Expect = 6.3 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -2 Query: 242 RVFGWLSSPILAYRNLSITFLTSMNTNININRLTTCY 132 R F L +L +R S+T L + +NI +L CY Sbjct: 72 RQFRDLGGQLLVFRGDSVTVLRRLFEELNIKKL--CY 106 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.0 bits (47), Expect = 8.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 544 ILREAFAPFGEISNCRI 594 ++REAF FG +S R+ Sbjct: 699 LVREAFEAFGRVSGARL 715 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 647,884 Number of Sequences: 2352 Number of extensions: 13309 Number of successful extensions: 24 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -