BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_A06 (348 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY071415-1|AAL49037.1| 150|Drosophila melanogaster RE49852p pro... 127 4e-30 AE014296-445|AAF47639.1| 150|Drosophila melanogaster CG1320-PA ... 127 4e-30 AY095176-1|AAM12269.1| 942|Drosophila melanogaster GH12763p pro... 27 4.9 AE014134-3279|AAF53921.2| 942|Drosophila melanogaster CG9323-PA... 27 4.9 >AY071415-1|AAL49037.1| 150|Drosophila melanogaster RE49852p protein. Length = 150 Score = 127 bits (306), Expect = 4e-30 Identities = 54/74 (72%), Positives = 64/74 (86%) Frame = +1 Query: 52 WYPIYQRGNPQLXVFLPNFWMKLVRPHPKQLPNIVHFHCSMEMTKYDIKNYLQKIYEVPV 231 WYPIYQRGNPQL VFLPNFWMKL+RP +Q PN+V F SMEMTKYD++NYL+KIY++PV Sbjct: 5 WYPIYQRGNPQLRVFLPNFWMKLIRPTEEQPPNVVTFSVSMEMTKYDVRNYLEKIYKLPV 64 Query: 232 VDVRTKINXGKLKK 273 VDVRT+I G+ KK Sbjct: 65 VDVRTRIAMGETKK 78 >AE014296-445|AAF47639.1| 150|Drosophila melanogaster CG1320-PA protein. Length = 150 Score = 127 bits (306), Expect = 4e-30 Identities = 54/74 (72%), Positives = 64/74 (86%) Frame = +1 Query: 52 WYPIYQRGNPQLXVFLPNFWMKLVRPHPKQLPNIVHFHCSMEMTKYDIKNYLQKIYEVPV 231 WYPIYQRGNPQL VFLPNFWMKL+RP +Q PN+V F SMEMTKYD++NYL+KIY++PV Sbjct: 5 WYPIYQRGNPQLRVFLPNFWMKLIRPTEEQPPNVVTFSVSMEMTKYDVRNYLEKIYKLPV 64 Query: 232 VDVRTKINXGKLKK 273 VDVRT+I G+ KK Sbjct: 65 VDVRTRIAMGETKK 78 >AY095176-1|AAM12269.1| 942|Drosophila melanogaster GH12763p protein. Length = 942 Score = 27.5 bits (58), Expect = 4.9 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 181 TKYDIKNYLQKIYEVPVVDVRTKINXGKLKKMLSRLCY 294 T YDI+ +Q + EV V T+ G+ ++ +CY Sbjct: 513 TNYDIETNIQSLDEVWVTKANTQQRRGRAGRVRPGICY 550 >AE014134-3279|AAF53921.2| 942|Drosophila melanogaster CG9323-PA protein. Length = 942 Score = 27.5 bits (58), Expect = 4.9 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 181 TKYDIKNYLQKIYEVPVVDVRTKINXGKLKKMLSRLCY 294 T YDI+ +Q + EV V T+ G+ ++ +CY Sbjct: 513 TNYDIETNIQSLDEVWVTKANTQQRRGRAGRVRPGICY 550 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,313,665 Number of Sequences: 53049 Number of extensions: 267250 Number of successful extensions: 786 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 777 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 786 length of database: 24,988,368 effective HSP length: 76 effective length of database: 20,956,644 effective search space used: 817309116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -