BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P04_F_A06 (348 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g78210.1 68414.m09114 hydrolase, alpha/beta fold family prote... 27 3.4 At4g16080.1 68417.m02438 hypothetical protein contains Pfam prof... 26 7.9 >At1g78210.1 68414.m09114 hydrolase, alpha/beta fold family protein low similarity to hydrolases from Rhodococcus sp. EtbD2 GI:3273241, EtbD1 GI:3273239; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 314 Score = 27.1 bits (57), Expect = 3.4 Identities = 12/49 (24%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = +1 Query: 103 NFWMKLVRPHPKQLPNIVHFH---CSMEMTKYDIKNYLQKIYEVPVVDV 240 NFW+ +P K PN++ H + YD+ L + + + + D+ Sbjct: 38 NFWVSKTKPESKPKPNLLLIHGLGATAIWQWYDVARRLSRYFNLYIPDL 86 >At4g16080.1 68417.m02438 hypothetical protein contains Pfam profile PF03478: Protein of unknown function (DUF295) Length = 379 Score = 25.8 bits (54), Expect = 7.9 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -1 Query: 132 MWSY*FHPKIRQKYXKLWVSSLINGVPAVWTLLK 31 +WS+ P +Y +L S L+ G ++W+LL+ Sbjct: 201 LWSWVGLPSTTPQYHELNFSILVTGHTSLWSLLQ 234 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,997,181 Number of Sequences: 28952 Number of extensions: 125532 Number of successful extensions: 267 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 260 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 267 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 429398688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -