BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_P23 (650 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 3e-27 SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) 112 3e-25 SB_52170| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) 83 1e-16 SB_31116| Best HMM Match : zf-C3HC4 (HMM E-Value=5.6e-10) 72 4e-13 SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) 53 2e-07 SB_16065| Best HMM Match : zf-C3HC4 (HMM E-Value=0.91) 52 4e-07 SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) 47 1e-05 SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) 47 1e-05 SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) 44 8e-05 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8285| Best HMM Match : Filamin (HMM E-Value=1.1e-09) 43 2e-04 SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) 42 4e-04 SB_15975| Best HMM Match : NHL (HMM E-Value=5e-09) 42 4e-04 SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 42 6e-04 SB_11979| Best HMM Match : zf-C3HC4 (HMM E-Value=0.061) 42 6e-04 SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) 41 8e-04 SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 41 8e-04 SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 41 8e-04 SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 41 8e-04 SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 41 8e-04 SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) 41 0.001 SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) 40 0.001 SB_54214| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 40 0.002 SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) 40 0.002 SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) 40 0.002 SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 40 0.002 SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_36856| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-05) 39 0.003 SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 39 0.003 SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) 39 0.004 SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) 39 0.004 SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_10859| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) 38 0.005 SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) 38 0.005 SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) 38 0.005 SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) 38 0.007 SB_24433| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) 38 0.007 SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) 38 0.009 SB_45256| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_33756| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0035) 37 0.012 SB_3354| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_33464| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0019) 37 0.012 SB_35671| Best HMM Match : zf-C3HC4 (HMM E-Value=0.01) 37 0.016 SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 37 0.016 SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) 37 0.016 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 36 0.022 SB_31765| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_30220| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_33822| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0022) 36 0.029 SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) 36 0.029 SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 36 0.038 SB_47830| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) 36 0.038 SB_7109| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0029) 35 0.050 SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 35 0.050 SB_49946| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.050 SB_11289| Best HMM Match : zf-TRAF (HMM E-Value=1.7e-08) 35 0.050 SB_2351| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-07) 35 0.066 SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) 35 0.066 SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) 34 0.087 SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.087 SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) 34 0.087 SB_38572| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0034) 34 0.12 SB_36857| Best HMM Match : zf-C3HC4 (HMM E-Value=2.8e-05) 34 0.12 SB_18584| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_14351| Best HMM Match : zf-B_box (HMM E-Value=2.3e-12) 34 0.12 SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) 33 0.15 SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) 33 0.15 SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_56584| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) 33 0.20 SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_19444| Best HMM Match : zf-C3HC4 (HMM E-Value=0.011) 33 0.20 SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) 33 0.27 SB_29534| Best HMM Match : cNMP_binding (HMM E-Value=7.8) 33 0.27 SB_20928| Best HMM Match : NHL (HMM E-Value=0) 32 0.35 SB_37330| Best HMM Match : S-antigen (HMM E-Value=4.1e-09) 32 0.47 SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.47 SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) 32 0.47 SB_54922| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0028) 32 0.47 SB_23054| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.62 SB_4080| Best HMM Match : zf-C3HC4 (HMM E-Value=0.23) 31 0.62 SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) 31 0.81 SB_24396| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.81 SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.81 SB_15354| Best HMM Match : NHL (HMM E-Value=4.4e-14) 31 1.1 SB_44886| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) 30 1.4 SB_30622| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-14) 30 1.4 SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) 30 1.4 SB_48473| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) 30 1.9 SB_45821| Best HMM Match : zf-B_box (HMM E-Value=1.1e-12) 29 3.3 SB_32308| Best HMM Match : MIF4G (HMM E-Value=1.5e-17) 29 3.3 SB_25653| Best HMM Match : U-box (HMM E-Value=0.0064) 29 3.3 SB_23234| Best HMM Match : U-box (HMM E-Value=0.0064) 29 3.3 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_6324| Best HMM Match : MCM (HMM E-Value=0) 29 3.3 SB_33424| Best HMM Match : zf-B_box (HMM E-Value=2.2e-18) 29 4.3 SB_18516| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_11042| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00013) 29 4.3 SB_39497| Best HMM Match : zf-C3HC4 (HMM E-Value=5.1e-12) 28 5.7 SB_13966| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 28 5.7 SB_41628| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 >SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1716 Score = 118 bits (285), Expect = 3e-27 Identities = 52/93 (55%), Positives = 68/93 (73%), Gaps = 2/93 (2%) Frame = +1 Query: 301 QRTLLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSAK 480 +R L ++N HI C LC GY + ATTIVECLHSFCRSCI+ L+A +CPVC+ ++ + Sbjct: 1353 RRMALKDLNPHIICVLCGGYLVDATTIVECLHSFCRSCIVSWLQASYHCPVCDTEVHKTR 1412 Query: 481 P--NIKLDKALQDIVYKLVPGLFQKEMERRQHF 573 P NI+ D LQDIVYKLVPGL+Q+E+ R+ F Sbjct: 1413 PFLNIRPDCVLQDIVYKLVPGLYQRELNYREEF 1445 >SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) Length = 510 Score = 112 bits (269), Expect = 3e-25 Identities = 50/91 (54%), Positives = 67/91 (73%), Gaps = 3/91 (3%) Frame = +1 Query: 304 RTL-LGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSAK 480 RTL L E+N HI C LC GY + ATTI+ECLHSFCR CI+++L+ CPVC+ I+ + Sbjct: 3 RTLSLKELNPHIICVLCGGYLVDATTIIECLHSFCRCCIVRYLETSYRCPVCDAEIHKTR 62 Query: 481 P--NIKLDKALQDIVYKLVPGLFQKEMERRQ 567 P NI+ D LQDIVYK+VPG++ +E +RR+ Sbjct: 63 PLLNIRADNVLQDIVYKVVPGMYFEEKKRRK 93 >SB_52170| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) Length = 291 Score = 83.4 bits (197), Expect = 1e-16 Identities = 32/73 (43%), Positives = 49/73 (67%) Frame = +1 Query: 277 NSNVAVVPQRTLLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVC 456 N +++ + + L E+N HI C LC GY + ATTI+ECLHSFCR CI+++L+ CPVC Sbjct: 27 NEDISTMLRTLSLKELNPHIICVLCGGYLVDATTIIECLHSFCRCCIVRYLETSYRCPVC 86 Query: 457 EMMINSAKPNIKL 495 + I+ +P + + Sbjct: 87 DAEIHKTRPLLNI 99 >SB_31116| Best HMM Match : zf-C3HC4 (HMM E-Value=5.6e-10) Length = 169 Score = 72.1 bits (169), Expect = 4e-13 Identities = 44/108 (40%), Positives = 59/108 (54%), Gaps = 26/108 (24%) Frame = +1 Query: 301 QRTL-LGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLK--AKSYCPVCEMMIN 471 +RTL L ++N ITC LC GY I TTI ECLH+FC+SCI+ +L+ + CP C +I+ Sbjct: 50 ERTLKLSDLNPFITCGLCEGYLIKPTTITECLHTFCKSCIVTYLQDSEDNTCPSCNTVIH 109 Query: 472 SAKP-----------------------NIKLDKALQDIVYKLVPGLFQ 546 P I+ D+ L+DIV+KLVPGL Q Sbjct: 110 ETNPFDLLRYMTGTMLGRGEDIEHPFRLIRSDQTLEDIVFKLVPGLQQ 157 >SB_43903| Best HMM Match : FHA (HMM E-Value=4.6e-13) Length = 553 Score = 52.8 bits (121), Expect = 2e-07 Identities = 29/112 (25%), Positives = 54/112 (48%), Gaps = 1/112 (0%) Frame = +1 Query: 301 QRTLLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSAK 480 +++++ E+ + +C +C +I ATT+ C HSFC C+ L+ ++ CP+C + S Sbjct: 358 RKSVVEEMEDEFSCIVCQELFIRATTLT-CSHSFCEYCLQSWLRKRNTCPICRCAVQSQP 416 Query: 481 -PNIKLDKALQDIVYKLVPGLFQKEMERRQHFYASRPXQAATATPXXXXEXT 633 +I LD A + K+V + ERR+ R ++ + T Sbjct: 417 VRSIVLDNA----IAKMVDSMDVASKERRRAVMEERAEKSRELAQSSGSQRT 464 >SB_16065| Best HMM Match : zf-C3HC4 (HMM E-Value=0.91) Length = 399 Score = 52.0 bits (119), Expect = 4e-07 Identities = 21/46 (45%), Positives = 31/46 (67%) Frame = +1 Query: 277 NSNVAVVPQRTLLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSC 414 N +++ + + L E+N HI C LC GY + ATTI+ECLHS+ +C Sbjct: 26 NEDISTMLRTLSLKELNPHIICVLCGGYLVDATTIIECLHSWQITC 71 >SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) Length = 207 Score = 47.2 bits (107), Expect = 1e-05 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 3/86 (3%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKS---YCPVCEMMINSAKPNIK 492 +N+ + C +C + T+ CLHSFC+ C+ K L +S +CP+C + +K Sbjct: 62 LNDELRCSVCYEVFSDPRTLTACLHSFCKECLHKMLSKRSKYIHCPLCRKKTAVPRRGVK 121 Query: 493 LDKALQDIVYKLVPGLFQKEMERRQH 570 L ++ +LV + M +H Sbjct: 122 -GLPLNSVIRRLVDVHSSEGMTSARH 146 >SB_29221| Best HMM Match : zf-C3HC4 (HMM E-Value=7.5e-10) Length = 337 Score = 47.2 bits (107), Expect = 1e-05 Identities = 26/93 (27%), Positives = 46/93 (49%), Gaps = 6/93 (6%) Frame = +1 Query: 328 EHITCPLCXGYYIXATTIVECLHSFCRSCIIKHL-KAKSYCPVCEMMINS-AKPNIK--- 492 E TCP+C + ++ C H FC+ C +++ +A CP+C + I+S A+ N + Sbjct: 33 EDFTCPICLQLLVEPV-VLPCEHEFCKMCFTQNVQEANLQCPMCRIRISSWARRNARNGT 91 Query: 493 -LDKALQDIVYKLVPGLFQKEMERRQHFYASRP 588 +D+ D + KL P +K + + F P Sbjct: 92 LVDRKRWDRIKKLFPKRCEKRIRGEEDFEDDHP 124 >SB_20056| Best HMM Match : zf-C3HC4 (HMM E-Value=9e-11) Length = 471 Score = 44.4 bits (100), Expect = 8e-05 Identities = 22/81 (27%), Positives = 40/81 (49%) Frame = +1 Query: 340 CPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSAKPNIKLDKALQDIV 519 C LC + T + C HSFCR C+ + L + CP C + K + +A+ ++ Sbjct: 330 CKLCFNLLLEPVTSL-CGHSFCRDCLYRSLDHRVECPCCRAPL--TKILAERRQAVTSVL 386 Query: 520 YKLVPGLFQKEMERRQHFYAS 582 ++ F + E+R++ YA+ Sbjct: 387 DGMIKDFFPVQYEKRKNLYAA 407 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 43.2 bits (97), Expect = 2e-04 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 8/73 (10%) Frame = +1 Query: 334 ITCPLCXGYYIXATTIVECLHSFCRSC---IIKHLKAKSY-CPVC----EMMINSAKPNI 489 +TC LC G Y ++ CLH++CR C +++H K + CP C E+ + K ++ Sbjct: 15 VTCSLCLGQY-QDPRVLACLHTYCRHCLESLVEHSKECTVSCPQCREKIEISVEEVK-SL 72 Query: 490 KLDKALQDIVYKL 528 K+D L D++ K+ Sbjct: 73 KVDFMLIDLIEKM 85 >SB_8285| Best HMM Match : Filamin (HMM E-Value=1.1e-09) Length = 474 Score = 42.7 bits (96), Expect = 2e-04 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVC-EMMINSAKP 483 V + CP C I I+ CLHS C++C+ K L CPVC E +N P Sbjct: 13 VGVSLYCPACSNV-IKDPRILPCLHSICKTCLEKQLNGCLKCPVCSEHAVNIKSP 66 >SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 42.3 bits (95), Expect = 3e-04 Identities = 25/89 (28%), Positives = 50/89 (56%), Gaps = 8/89 (8%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HL--KAKSYCPVC--EMMINSAK 480 + + +TC LC ++ ++ CLHSFCR C+ + H + K CP+C E I+ A Sbjct: 9 LEDEVTCSLCIEHF-NDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPAD 67 Query: 481 -PNIKLDKALQDIVYKLVPGLFQKEMERR 564 P++K++ + I+ ++P L ++ +++ Sbjct: 68 VPSLKVNFMINSII-SVLPLLTSEDSKKK 95 >SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) Length = 629 Score = 41.9 bits (94), Expect = 4e-04 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 8/78 (10%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HL--KAKSYCPVC--EMMINSAK 480 + + +TC LC ++ ++ CLHSFCR C+ + H K K CP+C E I+ A Sbjct: 129 LEDEVTCSLCIEHF-NDPRVLPCLHSFCRHCLEELAVHSEGKGKLVCPLCKSEFQISPAD 187 Query: 481 -PNIKLDKALQDIVYKLV 531 P++K++ + I+ L+ Sbjct: 188 VPSLKVNFMINSILSVLL 205 >SB_15975| Best HMM Match : NHL (HMM E-Value=5e-09) Length = 589 Score = 41.9 bits (94), Expect = 4e-04 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 4/56 (7%) Frame = +1 Query: 301 QRTLLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCI---IKHLKAKSY-CPVC 456 ++TL G +N+ +CP+C ++ ++ C H+ CR C+ ++K CPVC Sbjct: 10 EKTLSGVINDECSCPVCLEDFLEPKSLPNCAHNVCRKCLEGMATDSESKEIRCPVC 65 >SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 119 Score = 41.5 bits (93), Expect = 6e-04 Identities = 24/89 (26%), Positives = 50/89 (56%), Gaps = 8/89 (8%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HL--KAKSYCPVC--EMMINSAK 480 + + +TC +C ++ ++ CLHSFCR C+ + H + K CP+C E I+ A Sbjct: 9 LEDEVTCSICIEHF-NDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPAD 67 Query: 481 -PNIKLDKALQDIVYKLVPGLFQKEMERR 564 P++K++ + I+ ++P L ++ +++ Sbjct: 68 VPSLKVNFMINSII-SVLPLLTSEDSKKK 95 >SB_11979| Best HMM Match : zf-C3HC4 (HMM E-Value=0.061) Length = 63 Score = 41.5 bits (93), Expect = 6e-04 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMM 465 V E + C +C Y + C H C C ++ L AK CP C M+ Sbjct: 5 VTEKVKCLICMEPYTVPLVSISCWHVHCEECWLRTLGAKKLCPQCNMI 52 >SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) Length = 581 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/69 (26%), Positives = 36/69 (52%), Gaps = 3/69 (4%) Frame = +1 Query: 265 VKMDNSNVAVVPQRTLLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSY 444 V+ D+ ++ P ++ N ++ CPLC + ++ CLH+FC+ C+ + +S+ Sbjct: 120 VQRDDLDLGPTPDSPMMPGSNVNLFCPLCHEMFANPR-LLPCLHTFCKRCLENLVPPRSH 178 Query: 445 ---CPVCEM 462 CP C + Sbjct: 179 TLSCPSCRL 187 >SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 604 Score = 41.1 bits (92), Expect = 8e-04 Identities = 22/72 (30%), Positives = 42/72 (58%), Gaps = 7/72 (9%) Frame = +1 Query: 334 ITCPLCXGYYIXATTIVECLHSFCRSC---IIKHLKAKSY-CPVC-EMMINSAK--PNIK 492 +TC LC Y ++ CLH++CR C +++H + ++ CP C E ++ S + ++K Sbjct: 15 VTCSLCLEQY-QDPRVLACLHTYCRHCLESLVEHSQERTVSCPQCREKIVISVEEVKDLK 73 Query: 493 LDKALQDIVYKL 528 +D L D++ K+ Sbjct: 74 VDFMLNDMIRKM 85 >SB_56644| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 858 Score = 41.1 bits (92), Expect = 8e-04 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 340 CPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVC 456 CP+C T+ C H+FCR CI + K+ CP C Sbjct: 678 CPICLETITYPETLQGCGHTFCRPCITEASKSSKLCPTC 716 >SB_30107| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 911 Score = 41.1 bits (92), Expect = 8e-04 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 340 CPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVC 456 CP+C T+ C H+FCR CI + K+ CP C Sbjct: 753 CPICLETITYPETLQGCGHTFCRPCITEASKSSKLCPTC 791 >SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 462 Score = 41.1 bits (92), Expect = 8e-04 Identities = 22/72 (30%), Positives = 42/72 (58%), Gaps = 7/72 (9%) Frame = +1 Query: 334 ITCPLCXGYYIXATTIVECLHSFCRSC---IIKHLKAKSY-CPVC-EMMINSAK--PNIK 492 +TC LC Y ++ CLH++CR C +++H + ++ CP C E ++ S + ++K Sbjct: 15 VTCSLCLEQY-QDPRVLACLHTYCRHCLESLVEHSQERTVSCPQCREKIVISVEEVKDLK 73 Query: 493 LDKALQDIVYKL 528 +D L D++ K+ Sbjct: 74 VDFMLNDMIKKM 85 >SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) Length = 470 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/74 (25%), Positives = 42/74 (56%), Gaps = 7/74 (9%) Frame = +1 Query: 319 EVNEHITCPLCXGYYIXATTIVECLHSFCRSC---IIKHL-KAKSYCPVCEMMINSAK-- 480 ++ + +TC +C ++ ++ CLH+FCR C + +H K K CP+C++ A Sbjct: 8 QLEDEVTCAICIEHFTDPR-LLPCLHTFCRHCLEDLAEHSGKGKLVCPLCKVEYEIAVAD 66 Query: 481 -PNIKLDKALQDIV 519 P++K++ + +++ Sbjct: 67 IPSLKVNFPINNLI 80 >SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) Length = 316 Score = 40.3 bits (90), Expect = 0.001 Identities = 24/89 (26%), Positives = 50/89 (56%), Gaps = 8/89 (8%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HL--KAKSYCPVC--EMMINSAK 480 + + +TC +C + + ++ CLHSFCR C+ + H + K CP+C E I+ A Sbjct: 9 LEDEVTCSICIEH-LNDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPAD 67 Query: 481 -PNIKLDKALQDIVYKLVPGLFQKEMERR 564 P++K++ + I+ ++P L ++ +++ Sbjct: 68 VPSLKVNFMINSIL-SVLPLLTSEDSKKK 95 >SB_54214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +1 Query: 304 RTLLGEVNEHITCPLCXGYYIXATTIVECLHSFCRS 411 R + ++N H C LC GY I TI EC+H+ C+S Sbjct: 46 RVKVTDLNPHFICKLCNGYLINPVTITECIHT-CKS 80 >SB_46701| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 442 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/89 (25%), Positives = 49/89 (55%), Gaps = 8/89 (8%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HL--KAKSYCPVC--EMMINSAK 480 + + +TC +C ++ ++ C HSFCR C+ + H + K CP+C E I+ A Sbjct: 9 LEDEVTCSICIEHF-NDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPAD 67 Query: 481 -PNIKLDKALQDIVYKLVPGLFQKEMERR 564 P++K++ + I+ ++P L ++ +++ Sbjct: 68 VPSLKVNFMINSII-SVLPLLTSEDSKKK 95 >SB_21628| Best HMM Match : zf-B_box (HMM E-Value=1.4e-17) Length = 291 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/89 (25%), Positives = 49/89 (55%), Gaps = 8/89 (8%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HL--KAKSYCPVC--EMMINSAK 480 + + +TC +C ++ ++ C HSFCR C+ + H + K CP+C E I+ A Sbjct: 9 LEDEVTCSICIEHF-NDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPAD 67 Query: 481 -PNIKLDKALQDIVYKLVPGLFQKEMERR 564 P++K++ + I+ ++P L ++ +++ Sbjct: 68 VPSLKVNFMINSII-SVLPLLTSEDSKKK 95 >SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) Length = 599 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 8/73 (10%) Frame = +1 Query: 334 ITCPLCXGYYIXATTIVECLHSFCRSC---IIKHLKAKSY-CPVC----EMMINSAKPNI 489 +TC LC Y ++ CLH++CR C +++H K + CP C E+ + K ++ Sbjct: 24 VTCSLCLEQY-QDPRVLACLHTYCRHCLESLVEHSKECTVSCPQCREKIEISVEEVK-SL 81 Query: 490 KLDKALQDIVYKL 528 K+D L D++ K+ Sbjct: 82 KVDFMLIDLIEKM 94 >SB_47995| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 745 Score = 39.9 bits (89), Expect = 0.002 Identities = 23/89 (25%), Positives = 49/89 (55%), Gaps = 8/89 (8%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HL--KAKSYCPVC--EMMINSAK 480 + + +TC +C ++ ++ C HSFCR C+ + H + K CP+C E I+ A Sbjct: 9 LEDEVTCSICIEHF-NDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPAD 67 Query: 481 -PNIKLDKALQDIVYKLVPGLFQKEMERR 564 P++K++ + I+ ++P L ++ +++ Sbjct: 68 VPSLKVNFMINSII-SVLPLLTSEDSKKK 95 >SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 39.1 bits (87), Expect = 0.003 Identities = 24/89 (26%), Positives = 49/89 (55%), Gaps = 8/89 (8%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HL--KAKSYCPVC--EMMINSAK 480 + + +TC LC ++ ++ CLHSFCR C+ + H + K CP+C E I+ A Sbjct: 9 LEDEVTCSLCIEHF-NDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPAD 67 Query: 481 -PNIKLDKALQDIVYKLVPGLFQKEMERR 564 ++K++ + I+ ++P L ++ +++ Sbjct: 68 VSSLKVNFMINSII-SVLPLLTSEDSKKK 95 Score = 29.5 bits (63), Expect = 2.5 Identities = 18/64 (28%), Positives = 27/64 (42%) Frame = +1 Query: 247 ISDKKVVKMDNSNVAVVPQRTLLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKH 426 +S KV M NS ++V+P T + + C +C EC H C CI H Sbjct: 68 VSSLKVNFMINSIISVLPLLTS-EDSKKKTVCQMCDSGEPAQGRCNECDHFVCEQCISAH 126 Query: 427 LKAK 438 + + Sbjct: 127 KRLR 130 >SB_36856| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-05) Length = 406 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Frame = +1 Query: 307 TLLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSY----CPVC 456 TLLG+ CP+C ++ ++ C H+ CR C+ K K S CP+C Sbjct: 14 TLLGDEG---ACPVCIEVFVEPKSLPSCAHNVCRECLEKITKRNSIRFVECPIC 64 >SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 82 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 5/59 (8%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HL--KAKSYCPVCEMMINSAKP 483 + + +TC +C ++ ++ C HSFCR C+ + H + K CP+C+ SA P Sbjct: 9 LQDEVTCSICIEHF-NDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQSALP 66 >SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) Length = 691 Score = 38.7 bits (86), Expect = 0.004 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 8/73 (10%) Frame = +1 Query: 334 ITCPLCXGYYIXATTIVECLHSFCRSCIIK-----HLKAKSYCPVC--EMMINSAK-PNI 489 +TC LC + ++ CLH++C+ C+ K + YCP C E+ I A+ N+ Sbjct: 14 VTCLLCLDIFTDPR-LLPCLHTYCKKCLEDLVSQCQKKGEIYCPQCRHEVKITCAQVSNL 72 Query: 490 KLDKALQDIVYKL 528 K++ DI+ L Sbjct: 73 KINTVANDIIAAL 85 >SB_24485| Best HMM Match : zf-CCCH (HMM E-Value=3e-09) Length = 321 Score = 38.7 bits (86), Expect = 0.004 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 4/62 (6%) Frame = +1 Query: 319 EVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEM----MINSAKPN 486 E N C +C + + +CLH FC +C ++H K S C VC + + N AK Sbjct: 238 EDNLPFACIMCRKTF-KNPVVTKCLHYFCEACALQHYKKNSKCFVCGVQTYGVFNPAKDI 296 Query: 487 IK 492 IK Sbjct: 297 IK 298 >SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 5/58 (8%) Frame = +1 Query: 310 LLGEVNEH--ITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKS---YCPVCEMMI 468 L+ + +H + C +C Y ++ CLHSFC++C+ K ++++ CP C+ + Sbjct: 5 LVNRIQDHYRLVCGICQETY-NNPKVLPCLHSFCQNCLDKSIRSQERVLVCPTCQCSV 61 >SB_10859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 387 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 4/60 (6%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSC---IIKHLKAKSY-CPVCEMMINSAKPNI 489 + + I+CP+C + + +C H+ CR C II+ + + + CP+C ++ K I Sbjct: 19 IQDEISCPICYEDFEEPKCLPKCAHNICRECLLGIIEKAQLERFECPICRAIVAVPKDGI 78 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 38.7 bits (86), Expect = 0.004 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 8/67 (11%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HL--KAKSYCPVC--EMMINSAK 480 + + +TC LC ++ ++ C HSFCR C+ + H K K CP+C E I+ A Sbjct: 9 LEDEVTCSLCIEHF-NDPRVLPCFHSFCRHCLEELAVHSEGKGKLVCPLCKAEFQISPAD 67 Query: 481 -PNIKLD 498 P++K++ Sbjct: 68 VPSLKVN 74 >SB_36597| Best HMM Match : zf-C3HC4 (HMM E-Value=2.9e-07) Length = 346 Score = 38.3 bits (85), Expect = 0.005 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +1 Query: 313 LGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSY--CPVCEMMINS 474 +G++++++ C +C G A T + C HSFC SC+ L CP C + S Sbjct: 9 VGKIDQNLLCNICVGVLENAITTI-CGHSFCESCLETWLSRPEVQSCPSCRSHVLS 63 >SB_43880| Best HMM Match : zf-B_box (HMM E-Value=5.1e-15) Length = 405 Score = 38.3 bits (85), Expect = 0.005 Identities = 23/89 (25%), Positives = 48/89 (53%), Gaps = 8/89 (8%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HL--KAKSYCPVC--EMMINSAK 480 + + +TC +C ++ ++ C HSFCR C+ + H + K CP+C E I+ A Sbjct: 8 LEDEVTCSICIEHF-NDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPAD 66 Query: 481 -PNIKLDKALQDIVYKLVPGLFQKEMERR 564 P++K++ + I+ ++P L + +++ Sbjct: 67 VPSLKVNFMINSIL-SVLPLLTSDDSKKK 94 >SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 667 Score = 38.3 bits (85), Expect = 0.005 Identities = 25/90 (27%), Positives = 49/90 (54%), Gaps = 8/90 (8%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HL--KAKSYCPVC--EMMINSAK 480 + + +TC +C ++ ++ CLHSFCR C+ + H + K CP+C E I+ A Sbjct: 14 LQDEVTCSICIEHF-DDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPAD 72 Query: 481 -PNIKLDKALQDIVYKLVPGLFQKEMERRQ 567 ++K++ + I+ ++P LF E +++ Sbjct: 73 VSSLKVNFMINSII-SVLP-LFTSEDSKKK 100 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/60 (30%), Positives = 25/60 (41%) Frame = +1 Query: 247 ISDKKVVKMDNSNVAVVPQRTLLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKH 426 +S KV M NS ++V+P T + + C +C EC H C CI H Sbjct: 73 VSSLKVNFMINSIISVLPLFTS-EDSKKKTVCQMCDSGEPAQGRCNECDHFVCEQCISAH 131 >SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) Length = 463 Score = 38.3 bits (85), Expect = 0.005 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 8/90 (8%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HL--KAKSYCPVC--EMMINSAK 480 + + +TC +C ++ ++ CLHSFCR C+ + H + K CP+C E I+ A Sbjct: 9 LEDEVTCSICIEHF-NDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPAD 67 Query: 481 -PNIKLDKALQDIVYKLVPGLFQKEMERRQ 567 ++K++ + I+ L LF E +++ Sbjct: 68 VSSLKVNFMINSIISVL--SLFTSEDSKKK 95 >SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) Length = 584 Score = 37.9 bits (84), Expect = 0.007 Identities = 26/89 (29%), Positives = 48/89 (53%), Gaps = 7/89 (7%) Frame = +1 Query: 313 LGEVNEHITCPLCXGYYIXATTIVECLHSFCRSC---IIKHLKAKSY-CPVC--EMMINS 474 +G+V + +TC LC Y ++ CLH++CR C + +H + S CP C ++ I+ Sbjct: 8 VGDVKD-VTCCLCLEQY-QDPRVLACLHTYCRHCLESLAEHSQGDSISCPQCREKIQISV 65 Query: 475 AK-PNIKLDKALQDIVYKLVPGLFQKEME 558 K N+K D L +++ ++ +K+ E Sbjct: 66 DKVQNLKEDFLLSNLIKRISLSQGKKDEE 94 >SB_24433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 486 Score = 37.9 bits (84), Expect = 0.007 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = +1 Query: 340 CPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSAKPNIKLDKALQ 510 CP+C I + + C H CRSCI +HL C C+ ++++ D+A++ Sbjct: 430 CPICCAMRI-SVRFLPCRHVSCRSCITRHLMNNKECFFCKEVVDTLAEISADDQAIK 485 >SB_5871| Best HMM Match : IBR (HMM E-Value=0.00018) Length = 843 Score = 37.9 bits (84), Expect = 0.007 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 8/51 (15%) Frame = +1 Query: 334 ITCPLC-----XGYYIXATTIVECLHSFCRSCI--IKHLKAKSY-CPVCEM 462 +TCPLC GY I++C H+FC CI IK L+ CP C++ Sbjct: 328 LTCPLCYTAYGTGYPQRIPRILDCSHTFCTECIMKIKELQGDVVECPTCKL 378 >SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) Length = 594 Score = 37.5 bits (83), Expect = 0.009 Identities = 22/80 (27%), Positives = 43/80 (53%), Gaps = 7/80 (8%) Frame = +1 Query: 313 LGEVNEHITCPLCXGYYIXATTIVECLHSFCRSC---IIKHLKAKSY-CPVCEMMINSAK 480 +G+V + +TC LC Y ++ CLH++CR C +++H K + CP C I + Sbjct: 8 VGDVKD-VTCCLCLEQY-QDPRVLACLHTYCRHCLESLVEHSKECTVSCPQCREKIEISV 65 Query: 481 PNI---KLDKALQDIVYKLV 531 + K++ L+D++ ++ Sbjct: 66 DEVEELKVNFMLKDLIENML 85 >SB_45256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 37.1 bits (82), Expect = 0.012 Identities = 23/83 (27%), Positives = 38/83 (45%) Frame = +1 Query: 310 LLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSAKPNI 489 LL + + ++C +C G + CLH CR C+ K ++ P C +N Sbjct: 31 LLPRLRQSLSCRVCRGLVVDPFGSQSCLHYVCRGCL---RKKRALNPGCRWCLN------ 81 Query: 490 KLDKALQDIVYKLVPGLFQKEME 558 LDK ++D K+V ++K E Sbjct: 82 -LDKLVEDRQTKIVLACYRKLCE 103 >SB_33756| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0035) Length = 351 Score = 37.1 bits (82), Expect = 0.012 Identities = 23/83 (27%), Positives = 38/83 (45%) Frame = +1 Query: 310 LLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSAKPNI 489 LL + + ++C +C G + CLH CR C+ K ++ P C +N Sbjct: 31 LLPRLRQSLSCRVCRGLVVDPFGSQSCLHYVCRGCL---RKKRALNPGCRWCLN------ 81 Query: 490 KLDKALQDIVYKLVPGLFQKEME 558 LDK ++D K+V ++K E Sbjct: 82 -LDKLVEDRQTKIVLACYRKLCE 103 >SB_3354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 632 Score = 37.1 bits (82), Expect = 0.012 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 5/60 (8%) Frame = +1 Query: 304 RTLLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSY-----CPVCEMMI 468 +++L + E +TC C + I CLHSFC C+ + +++ Y CP C+ I Sbjct: 4 QSILENLEELLTCRQCSNVF-KNPRITPCLHSFCAECLNEIARSRPYQAYIACPTCKYEI 62 >SB_33464| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0019) Length = 413 Score = 37.1 bits (82), Expect = 0.012 Identities = 22/91 (24%), Positives = 40/91 (43%), Gaps = 3/91 (3%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSY--CPVCEMMINSAKPNIKL 495 + E I CP+C + + C H+ C SC+ K + + CP+C P L Sbjct: 16 LQEEICCPICTEIFETPKCLPVCAHNVCLSCLKKMKIEQGFIKCPICRKKTKITNPAESL 75 Query: 496 -DKALQDIVYKLVPGLFQKEMERRQHFYASR 585 +L + + PG ++E+E R+ ++ Sbjct: 76 PTNSLLVRLVENAPGR-KEELELRKELKTAK 105 >SB_35671| Best HMM Match : zf-C3HC4 (HMM E-Value=0.01) Length = 527 Score = 36.7 bits (81), Expect = 0.016 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = +1 Query: 301 QRTLLGEVN-EHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSA 477 +R L EV + CP+C + H+ C +C+ + L S CPVC+ +++S Sbjct: 238 ERFELNEVRKDDFYCPICSELLDKPVETI-FTHNACDACLTQALAVNSLCPVCKTILSSG 296 Query: 478 KPNIKLDKALQDIV 519 K ++ L ++ Sbjct: 297 DDIKKFNRTLLGLI 310 >SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 36.7 bits (81), Expect = 0.016 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 5/51 (9%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HL--KAKSYCPVCE 459 + + +TC +C ++ ++ CLHSFCR C+ + H + K CP+C+ Sbjct: 9 LEDEVTCSICIEHF-NDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCK 58 >SB_44019| Best HMM Match : TPR_2 (HMM E-Value=4.9e-12) Length = 654 Score = 36.7 bits (81), Expect = 0.016 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 328 EHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVC 456 E C LC + T C H FCR+C+ + L + CP+C Sbjct: 375 EEFECTLCCRLFYNPVT-TPCGHVFCRACLNRSLDHRPGCPIC 416 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 36.7 bits (81), Expect = 0.016 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 5/51 (9%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HL--KAKSYCPVCE 459 + + +TC +C ++ ++ CLHSFCR C+ + H + K CP+C+ Sbjct: 8 LEDEVTCSICIEHF-NDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCK 57 >SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) Length = 398 Score = 36.3 bits (80), Expect = 0.022 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +1 Query: 328 EHITCPLCXGYYI--XATTIVECLHSFCRSCIIKHLKAKSYCPVC 456 E +CP+C + T ++ C H +C C+ + L+ + CP+C Sbjct: 258 ESKSCPICLEEFTPETPTRLLVCGHKYCEPCLSRWLENNTTCPIC 302 >SB_31765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 35.9 bits (79), Expect = 0.029 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 1/84 (1%) Frame = +1 Query: 301 QRTLLGEVN-EHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSA 477 +R L EV + CP+C + H+ C +C+ + L S CPVC+ +++S Sbjct: 98 ERFELNEVRKDDFYCPICSELLDKPVETI-FTHNACGACLTQALAVNSSCPVCKTILSSG 156 Query: 478 KPNIKLDKALQDIVYKLVPGLFQK 549 K ++ QDI KL+ G +++ Sbjct: 157 DDIKKFNQ--QDI--KLLCGYYRE 176 >SB_30220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 35.9 bits (79), Expect = 0.029 Identities = 20/63 (31%), Positives = 27/63 (42%) Frame = +1 Query: 340 CPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSAKPNIKLDKALQDIV 519 C C G I C H C C K L + + CP C +N P+I DKA + + Sbjct: 431 CLDCEGLLWYPVQIKPCGHRVCTKCYTKLLSSSARCPGCMDELNENIPDI--DKAFHEEI 488 Query: 520 YKL 528 +L Sbjct: 489 QEL 491 >SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 35.9 bits (79), Expect = 0.029 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 5/67 (7%) Frame = +1 Query: 307 TLLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHL-----KAKSYCPVCEMMIN 471 +L+ + E + CP+C G Y ++ C HSFC C+ + L K CP C + Sbjct: 9 SLVRGLAEQLMCPVCLGEY-KNPMLLRCYHSFCLRCVQELLHQSGEKGVVKCPQCRTEME 67 Query: 472 SAKPNIK 492 ++K Sbjct: 68 IPNSDVK 74 >SB_33822| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0022) Length = 229 Score = 35.9 bits (79), Expect = 0.029 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Frame = +1 Query: 301 QRTLLGEVN-EHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSA 477 +R L EV + CP+C + H+ C +C+ + L S CPVC+ +++S Sbjct: 119 KRFELNEVRKDDFYCPICSELLDKPVETI-FTHNACGACLTQALAVNSSCPVCKTILSSG 177 Query: 478 KPNIKLDKALQDIV 519 K ++ L ++ Sbjct: 178 DDIKKFNRTLLGLI 191 >SB_8282| Best HMM Match : NHL (HMM E-Value=9.2e-23) Length = 877 Score = 35.9 bits (79), Expect = 0.029 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 4/54 (7%) Frame = +1 Query: 319 EVNEHITCPLCXGYYIXATTIVECLHSFCRSC---IIKHLKA-KSYCPVCEMMI 468 ++ + + C +C A ++ CLH++CR C II H ++ +++CP C I Sbjct: 138 DIRQQLACGICHALLRDAR-VLPCLHTYCRRCIEDIILHRQSVRAHCPSCNREI 190 >SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 35.5 bits (78), Expect = 0.038 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 3/61 (4%) Frame = +1 Query: 319 EVNEHITCPLCXGYYIXATTIVECLHSFCRSC---IIKHLKAKSYCPVCEMMINSAKPNI 489 E+++H+ C LC I ++ CLHSFC +C ++ CP C +K + Sbjct: 13 ELSKHLNCSLCHRL-IRGPKLLPCLHSFCLACLEDLVTENDVGFNCPQCHTEAKVSKAAL 71 Query: 490 K 492 + Sbjct: 72 R 72 >SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 35.5 bits (78), Expect = 0.038 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 5/47 (10%) Frame = +1 Query: 334 ITCPLCXGYYIXATTIVECLHSFCRSCIIK---HL--KAKSYCPVCE 459 +TC +C ++ ++ CLHSFCR C+ + H + K CP+C+ Sbjct: 13 VTCSICIEHF-NDPRVLPCLHSFCRHCLEELAVHSEGRGKLVCPLCK 58 >SB_47830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 767 Score = 35.5 bits (78), Expect = 0.038 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 5/49 (10%) Frame = +1 Query: 328 EHITCPLCXGYYIXATTIVECLHSFCRSCIIK-----HLKAKSYCPVCE 459 E +TC C G+Y + CLH+FC C+ K L + CP C+ Sbjct: 14 ERLTCSACKGFYKNPKRL-PCLHAFCCHCLKKTQRGTKLCERMRCPTCD 61 >SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) Length = 645 Score = 35.5 bits (78), Expect = 0.038 Identities = 14/57 (24%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = +1 Query: 295 VPQRTLLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HLKAKSYCPVC 456 + ++ + +V E +TC +C + ++ C H+FC+ C+ K + CP C Sbjct: 7 ISSQSSIEKVREELTCSVCLEQF-REPKMLPCFHTFCKECLEKTKQSFRGNLLCPTC 62 >SB_7109| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0029) Length = 232 Score = 35.1 bits (77), Expect = 0.050 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Frame = +1 Query: 301 QRTLLGEVN-EHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSA 477 QR L E+ + CP+C + H+ C +C+ + L S CPVC+ +++S Sbjct: 72 QRFELNEIRKDDFYCPICCELLDKPVETI-FTHNACGACLTQALAVNSSCPVCKTILSSG 130 Query: 478 KPNIKLDKALQDIV 519 K + L ++ Sbjct: 131 DDIKKFNHTLLGLI 144 >SB_6888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1257 Score = 35.1 bits (77), Expect = 0.050 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 340 CPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEM 462 CPLC T + C + FC CI ++L CPV + Sbjct: 1201 CPLCAKVRTNPTALSTCGYVFCYPCIYRYLGQHGCCPVTHL 1241 >SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 89 Score = 35.1 bits (77), Expect = 0.050 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 5/51 (9%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HL--KAKSYCPVCE 459 + + +TC +C ++ ++ C HSFCR C+ + H + K CP+C+ Sbjct: 9 LEDEVTCSICIEHF-NDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCK 58 >SB_49946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 35.1 bits (77), Expect = 0.050 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +1 Query: 337 TCPLCXGYYIX--ATTIVECLHSFCRSCIIKHLKAKSYCPVC 456 +CP+C G Y +T + C H F CI+ L+ + CPVC Sbjct: 61 SCPICLGDYEKGESTKQMPCDHLFHPGCILPWLEKTNSCPVC 102 >SB_11289| Best HMM Match : zf-TRAF (HMM E-Value=1.7e-08) Length = 230 Score = 35.1 bits (77), Expect = 0.050 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 4/60 (6%) Frame = +1 Query: 316 GEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLK--AKSYCPV--CEMMINSAKP 483 G + +I CP+C + I H FCRSC++ HL+ CP+ E+ + +P Sbjct: 11 GPADPNIICPICQ-FIIEDAVCCPQGHIFCRSCVVVHLQQFGNGNCPLDRSELSLEDIRP 69 >SB_2351| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-07) Length = 137 Score = 34.7 bits (76), Expect = 0.066 Identities = 18/71 (25%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Frame = +1 Query: 319 EVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKA-KSYCPVCEMMINSAKPNIKL 495 E +H+ CP+C ++ I EC H C+ C ++ + CP C ++ P++ Sbjct: 49 EERKHL-CPVCEDIFVSPVQIKECGHRLCQHCYKTIWRSPEPKCPKCSGDLDDKIPDV-- 105 Query: 496 DKALQDIVYKL 528 D+A ++ + +L Sbjct: 106 DQAFENDMNEL 116 >SB_9017| Best HMM Match : zf-C3HC4 (HMM E-Value=7.9e-12) Length = 203 Score = 34.7 bits (76), Expect = 0.066 Identities = 14/58 (24%), Positives = 30/58 (51%), Gaps = 5/58 (8%) Frame = +1 Query: 310 LLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCII-----KHLKAKSYCPVCEMMI 468 ++ + + + CP+C + ++ CLH+FC C++ + K CP C+M++ Sbjct: 6 IVERLQKEVECPICLERF-KDPRVLPCLHTFCYECLVGLASRYKTEGKWPCPQCKMVV 62 >SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) Length = 355 Score = 34.3 bits (75), Expect = 0.087 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 8/67 (11%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HL--KAKSYCPVC--EMMINSAK 480 + + + C +C ++ ++ C HSFCR C+ + H + K CP+C E I+ A Sbjct: 9 LEDEVRCSICIEHF-NDPRVLPCFHSFCRHCLEELAVHSEGRGKLVCPLCKAEFQISPAD 67 Query: 481 -PNIKLD 498 P++K++ Sbjct: 68 VPSLKVN 74 >SB_57045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 34.3 bits (75), Expect = 0.087 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 5/54 (9%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCII-----KHLKAKSYCPVCEMMI 468 + + + CP+C + ++ CLH+FC C++ + K CP C+M++ Sbjct: 10 LQKEVECPICLERF-KDPRVLPCLHTFCYECLVGLASRYKTEGKWPCPQCKMVV 62 >SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) Length = 310 Score = 34.3 bits (75), Expect = 0.087 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = +1 Query: 313 LGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCP 450 +G VNE + C +C + + C HS+C +C++ L + CP Sbjct: 9 VGAVNEGLLCCICRDV-LEEPLMAPCEHSYCSACVLGWLTHYNTCP 53 >SB_38572| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0034) Length = 671 Score = 33.9 bits (74), Expect = 0.12 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 394 HSFCRSCIIKHLKAKSYCPVCEMMINSAKPNIKL 495 H FC C+ L+ YCP C IN +P K+ Sbjct: 120 HVFCSPCLDLWLRTNRYCPTCRTPINQDQPVKKI 153 >SB_36857| Best HMM Match : zf-C3HC4 (HMM E-Value=2.8e-05) Length = 576 Score = 33.9 bits (74), Expect = 0.12 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Frame = +1 Query: 307 TLLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKS----YCPVC 456 TLLG+ CP+C + ++ C H+ CR C+ K S CP+C Sbjct: 14 TLLGDEG---ACPVCIEVFEEPKSLPSCAHNVCRECLEKITARNSSRFVECPIC 64 >SB_18584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1022 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +1 Query: 340 CPLCXGYYIXATTIVECLHSFCRSCIIK---HLKAKSYCPVCE 459 C +C Y + CLHSFC+ C+ K + K CP C+ Sbjct: 405 CGVCRETYTDPR-VAPCLHSFCKECVTKLVTERQGKFVCPDCQ 446 >SB_14351| Best HMM Match : zf-B_box (HMM E-Value=2.3e-12) Length = 549 Score = 33.9 bits (74), Expect = 0.12 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 7/74 (9%) Frame = +1 Query: 313 LGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKS---YCPVC----EMMIN 471 L ++ E I C C G + ++ CLHS C+ C+ +A+ CPVC E + Sbjct: 12 LEDLPEEIWCRYCNGIF-EDPRLLPCLHSLCKKCLKDIEQAQEGAIACPVCLTDVECHLE 70 Query: 472 SAKPNIKLDKALQD 513 PN+ L++ Sbjct: 71 ELLPNVLARSKLKE 84 >SB_54221| Best HMM Match : zf-B_box (HMM E-Value=2.1e-17) Length = 455 Score = 33.5 bits (73), Expect = 0.15 Identities = 21/89 (23%), Positives = 47/89 (52%), Gaps = 8/89 (8%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HL--KAKSYCPVC--EMMINSAK 480 + + +TC +C ++ ++ C HSFC C+ + H + K CP+C E I+ A Sbjct: 9 LEDEVTCSICIEHF-NDPRVLPCFHSFCLHCLEELAVHSEGRGKLVCPLCKAEFQISPAD 67 Query: 481 P-NIKLDKALQDIVYKLVPGLFQKEMERR 564 ++K++ + I+ ++P L ++ +++ Sbjct: 68 VLSLKVNFMINSII-SVLPLLTSEDSKKK 95 >SB_8394| Best HMM Match : zf-C3HC4 (HMM E-Value=8.6e-08) Length = 1631 Score = 33.5 bits (73), Expect = 0.15 Identities = 15/46 (32%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = +1 Query: 328 EHITCPLCXGYYIXATTIVECLHSFCRSCI---IKHLKAKSYCPVC 456 E I+CP+C + + C HS C C+ K CPVC Sbjct: 19 EEISCPVCLEVFEEPLVLPSCGHSVCLQCLQNMTKRNPPSLLCPVC 64 >SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 33.5 bits (73), Expect = 0.15 Identities = 15/59 (25%), Positives = 27/59 (45%), Gaps = 4/59 (6%) Frame = +1 Query: 328 EHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKS----YCPVCEMMINSAKPNIK 492 + + CP+C + T+ C+H CR C+ +S CP+C I+ + +K Sbjct: 17 DELLCPICLDEFKEPKTL-SCMHDLCRKCLEDMAARESSRVIRCPLCRSEIDIPRGGVK 74 >SB_56584| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) Length = 158 Score = 33.1 bits (72), Expect = 0.20 Identities = 24/88 (27%), Positives = 37/88 (42%), Gaps = 5/88 (5%) Frame = +1 Query: 226 KMVTSNIISDK-KVVKMDNSNVAVVPQRTLLGEVNEH---ITCPLCXGYYIXATTIVECL 393 K V +S K K+ K ++ LL EV ++ +TCP C A + +C Sbjct: 64 KRVQEECVSLKRKLEKQKKIDLYGAADEVLLEEVRQYKARLTCPCCNTRKKDAI-LTKCF 122 Query: 394 HSFCRSCI-IKHLKAKSYCPVCEMMINS 474 H FC C+ ++ + CP C S Sbjct: 123 HVFCYECLKTRYDTRQRKCPKCNATFGS 150 >SB_53040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 33.1 bits (72), Expect = 0.20 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 301 QRTL-LGEVNEHITCPLCXGYYIXATTI 381 +RTL L ++N ITC LC GY I TTI Sbjct: 17 ERTLKLSDLNPFITCGLCEGYLIKPTTI 44 >SB_19444| Best HMM Match : zf-C3HC4 (HMM E-Value=0.011) Length = 434 Score = 33.1 bits (72), Expect = 0.20 Identities = 18/69 (26%), Positives = 32/69 (46%), Gaps = 4/69 (5%) Frame = +1 Query: 319 EVNEHITCPLC----XGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSAKPN 486 +++ H+ CPLC G ++ C H+FC+ C K CP C+M + + N Sbjct: 229 DMSTHL-CPLCQTLMSGSRHTPVALIPCGHTFCQMCTRDCRK----CPDCQMRVKATAVN 283 Query: 487 IKLDKALQD 513 + + + D Sbjct: 284 TVMQQIIGD 292 >SB_18658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 33.1 bits (72), Expect = 0.20 Identities = 14/52 (26%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Frame = +1 Query: 313 LGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPV-CEMM 465 L V + C +C G + + C H FC C++ + CP+ CE + Sbjct: 48 LDPVEDDFKCGICFGV-LEDPLVTTCGHVFCSQCLVHWIAENGTCPLTCEQL 98 >SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) Length = 1387 Score = 32.7 bits (71), Expect = 0.27 Identities = 14/63 (22%), Positives = 31/63 (49%), Gaps = 5/63 (7%) Frame = +1 Query: 310 LLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAK-----SYCPVCEMMINS 474 ++ +E CP+C + + I+ CLH++C C+ + ++++ CP C ++ Sbjct: 649 IIRSAHESSCCPICSRPF-KSPKILPCLHTYCSDCVKEIVRSRLGKLTLQCPKCPRSVDI 707 Query: 475 AKP 483 P Sbjct: 708 PDP 710 >SB_29534| Best HMM Match : cNMP_binding (HMM E-Value=7.8) Length = 268 Score = 32.7 bits (71), Expect = 0.27 Identities = 17/43 (39%), Positives = 29/43 (67%) Frame = +1 Query: 412 CIIKHLKAKSYCPVCEMMINSAKPNIKLDKALQDIVYKLVPGL 540 C+I + A+++ + ++ +SA + DK L+DI+YKLVPGL Sbjct: 68 CVIDN--ARNHSMIVFLLASSAL--YRSDKTLEDIIYKLVPGL 106 >SB_20928| Best HMM Match : NHL (HMM E-Value=0) Length = 795 Score = 32.3 bits (70), Expect = 0.35 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = +1 Query: 340 CPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSAKPNIKLDKALQD 513 CP C Y ++ CLH+FC C+ + L CE +N P D L+D Sbjct: 15 CPKCMNAY-ENPKVLPCLHTFCSQCLSEELHRD-----CEGRLNVTCPKCLRDFPLRD 66 >SB_37330| Best HMM Match : S-antigen (HMM E-Value=4.1e-09) Length = 818 Score = 31.9 bits (69), Expect = 0.47 Identities = 17/57 (29%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = +1 Query: 289 AVVPQRTLLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKH-LKAKSYCPVC 456 A VP +V + CP+C I C S+C CI + L+ + CP C Sbjct: 42 ADVPAAKADRKVPSELRCPMCKNLLTDTVLIPCCGTSYCDECIRTYLLENEQECPTC 98 >SB_31692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 31.9 bits (69), Expect = 0.47 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 328 EHITCPLCXGYYIXATTIVECLHSFCRSCI 417 E CP+C + I EC H FC+SC+ Sbjct: 22 EEYECPICQLAFRDPIQIEECGHRFCQSCL 51 >SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) Length = 784 Score = 31.9 bits (69), Expect = 0.47 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 9/73 (12%) Frame = +1 Query: 334 ITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKS-------YCPVCEMM--INSAKPN 486 + C +C + ++ CLHSFC+SC I+ L K+ CPVC+ + I + + Sbjct: 60 LICRVCNQRF-NKPKLLHCLHSFCQSC-IEGLARKTEDDCLELICPVCDSLGAIPRSVES 117 Query: 487 IKLDKALQDIVYK 525 + + AL D V K Sbjct: 118 LPTNFALWDTVRK 130 >SB_54922| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0028) Length = 116 Score = 31.9 bits (69), Expect = 0.47 Identities = 17/57 (29%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Frame = +1 Query: 289 AVVPQRTLLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKH-LKAKSYCPVC 456 A VP +V + CP+C I C S+C CI + L+ + CP C Sbjct: 42 ADVPAAKADRKVPSELRCPMCKNLLTDTVLIPCCGTSYCDECIRTYLLENEQECPTC 98 >SB_23054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 482 Score = 31.5 bits (68), Expect = 0.62 Identities = 18/79 (22%), Positives = 32/79 (40%), Gaps = 2/79 (2%) Frame = +1 Query: 337 TCPLCXGYY--IXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSAKPNIKLDKALQ 510 TC +C Y + ++C H F R CI L +S CPV + + + + Sbjct: 211 TCGVCLSAYHPLQYVRKLQCRHVFHRDCIDSWLATQSICPVDGQTVGVSYMGVAHTEVAP 270 Query: 511 DIVYKLVPGLFQKEMERRQ 567 ++ V G + + R+ Sbjct: 271 PVINSAVQGAARGRLLNRR 289 >SB_13054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 549 Score = 31.5 bits (68), Expect = 0.62 Identities = 12/47 (25%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +1 Query: 325 NEHITCPLCXGYYIXATTIVECLHSFCRSCIIK---HLKAKSYCPVC 456 +E +TCP+C + C H+ C+ C+ + + + + CP C Sbjct: 12 SEELTCPVCLEELKEPKCLTSCAHNVCKPCLDRMTFNGEKEIRCPTC 58 >SB_4080| Best HMM Match : zf-C3HC4 (HMM E-Value=0.23) Length = 203 Score = 31.5 bits (68), Expect = 0.62 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +1 Query: 388 CLHSFCRSCIIKHLKAKSYCPVCEMMINSAKPNIKLDKALQDIVYKL 528 C+HSFC SC + ++ CP + A NI +D+ LQ + KL Sbjct: 81 CMHSFCASCYSQWMEHSRDCPSNYL----AGKNIGVDELLQKCLEKL 123 >SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21) Length = 380 Score = 31.1 bits (67), Expect = 0.81 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +1 Query: 340 CPLCXGYYIXATTIVECLHSFCRSC---IIKHLKAKSYCPVCEMMIN 471 CP+C + +I C H FC C +I++ CP+C +N Sbjct: 65 CPICLDP-LDDPSITRCAHVFCTGCLTDVIENEGLAPRCPMCRAPVN 110 >SB_24396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 31.1 bits (67), Expect = 0.81 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 12/78 (15%) Frame = +1 Query: 328 EHITCPLCXGYYIXATTIVECLHSFCRSCIIKH--LKAKS---YCPVC-------EMMIN 471 + + C C + I++CLH+FC+ C+ H L A + CP+C E + Sbjct: 12 QSLNCRACHKVF-TEPKILDCLHTFCQKCLGTHDILGAGTNSIVCPLCRKPTPIPESGVE 70 Query: 472 SAKPNIKLDKALQDIVYK 525 S N L+ AL + K Sbjct: 71 SLPSNFLLNNALDQLSVK 88 >SB_4488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 645 Score = 31.1 bits (67), Expect = 0.81 Identities = 14/59 (23%), Positives = 30/59 (50%) Frame = +1 Query: 340 CPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSAKPNIKLDKALQDI 516 CPLC + I C H+FC++CI+ + CP+ + ++ N+ + + + ++ Sbjct: 194 CPLCRRVF-KDPVITSCGHTFCQACIM--ARGVEKCPLDDNKLSIVVANLAVAEQIGEL 249 >SB_15354| Best HMM Match : NHL (HMM E-Value=4.4e-14) Length = 1071 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +1 Query: 310 LLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK 423 LL + + ITCP C + ++ CL S CRSC K Sbjct: 109 LLENLTKFITCPSCKET-MNDPVLLPCLDSICRSCCQK 145 >SB_44886| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-06) Length = 406 Score = 30.3 bits (65), Expect = 1.4 Identities = 20/83 (24%), Positives = 35/83 (42%), Gaps = 1/83 (1%) Frame = +1 Query: 229 MVTSNIISDKKVVKMDNSNVAVVPQRTLLGEVNEHITCPLCXGYYIXATTIVECLHSFCR 408 MV+ ++ + VV+ S+ + L+ +TCP C A + +C H FC Sbjct: 318 MVSIVYMTPRSVVRA-RSHFRLASDHNLVLFHQARLTCPCCNTRKKDAI-LTKCFHVFCY 375 Query: 409 SCI-IKHLKAKSYCPVCEMMINS 474 C+ ++ + CP C S Sbjct: 376 ECLKTRYDTRQRKCPKCNATFGS 398 >SB_30622| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-14) Length = 856 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Frame = +1 Query: 379 IVECLHSFCRSCIIK---HLKAKSYCPVCE 459 ++EC H++C SCIIK K + CP C+ Sbjct: 407 LLECGHTYCDSCIIKLSRLQKTQVACPECQ 436 >SB_14063| Best HMM Match : zf-C3HC4 (HMM E-Value=1.4e-08) Length = 301 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 3/52 (5%) Frame = +1 Query: 328 EHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKA---KSYCPVCEMMINS 474 + + C +C + C H FC CI + L KS CPVC+ I+S Sbjct: 156 DFVFCAICKEV-LTQPIATPCDHYFCVLCICEWLDQTYNKSGCPVCKASISS 206 >SB_48473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 20 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +1 Query: 496 DKALQDIVYKLVPGLF 543 D LQDIVYK+VPG++ Sbjct: 3 DNVLQDIVYKVVPGMY 18 >SB_5773| Best HMM Match : HA2 (HMM E-Value=3e-16) Length = 2352 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/39 (28%), Positives = 17/39 (43%) Frame = +1 Query: 340 CPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVC 456 CP C + C H +CR C+ ++AK + C Sbjct: 1951 CPACFCEVDNPYQLATCGHVYCRGCVTNLIEAKQFPLTC 1989 >SB_45821| Best HMM Match : zf-B_box (HMM E-Value=1.1e-12) Length = 379 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK 423 + + ITCP C + ++ CL S CRSC K Sbjct: 21 LTKFITCPSCKET-MNGPVLLPCLDSICRSCCQK 53 >SB_32308| Best HMM Match : MIF4G (HMM E-Value=1.5e-17) Length = 605 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIK 423 + + ITCP C + ++ CL S CRSC K Sbjct: 21 LTKFITCPSCKET-MNGPVLLPCLDSICRSCCQK 53 >SB_25653| Best HMM Match : U-box (HMM E-Value=0.0064) Length = 336 Score = 29.1 bits (62), Expect = 3.3 Identities = 18/73 (24%), Positives = 32/73 (43%) Frame = +1 Query: 310 LLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSAKPNI 489 + G+ + C +C + + C HS C SC + + K CP C A + Sbjct: 46 ITGDAPDDFICNVCGTVMLVPVVMPNCGHSCCSSC-AERVNRK--CPECREEF-GATAEL 101 Query: 490 KLDKALQDIVYKL 528 K + +L+ I+ +L Sbjct: 102 KENISLKRIIRRL 114 >SB_23234| Best HMM Match : U-box (HMM E-Value=0.0064) Length = 349 Score = 29.1 bits (62), Expect = 3.3 Identities = 18/73 (24%), Positives = 32/73 (43%) Frame = +1 Query: 310 LLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSAKPNI 489 + G+ + C +C + + C HS C SC + + K CP C A + Sbjct: 46 ITGDAPDDFICNVCGTVMLVPVVMPNCGHSCCSSC-AERVNRK--CPECREEF-GATAEL 101 Query: 490 KLDKALQDIVYKL 528 K + +L+ I+ +L Sbjct: 102 KENISLKRIIRRL 114 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 29.1 bits (62), Expect = 3.3 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +1 Query: 307 TLLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCI 417 TLL + E C LC + I+ C H +C+ C+ Sbjct: 3 TLLPYLREKCKCSLCSEV-LTEPKILRCFHVYCQKCL 38 >SB_7188| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1094 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/53 (26%), Positives = 18/53 (33%) Frame = +1 Query: 322 VNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSAK 480 V C C Y+ + C H C C K K CP+C + K Sbjct: 12 VPSEFLCSYCRKVYLHPL-VTGCGHVLCTKCYNKRSKKHLGCPLCGKSMGEGK 63 >SB_6324| Best HMM Match : MCM (HMM E-Value=0) Length = 1592 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/54 (27%), Positives = 29/54 (53%) Frame = -2 Query: 517 LCPAVLCQV*YWVLPNLSSFHIQDSSSLL*GV**YNYDKRNASIPLLWSHXCST 356 + A++C + ++P ++ H D S + + N ++ +A I +WSH CST Sbjct: 1513 IATAMVCYIPIHLMPMINIIHRSDMSIMCAQI--ANQEREDA-ITAMWSHKCST 1563 >SB_33424| Best HMM Match : zf-B_box (HMM E-Value=2.2e-18) Length = 270 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/60 (30%), Positives = 25/60 (41%) Frame = +1 Query: 247 ISDKKVVKMDNSNVAVVPQRTLLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKH 426 +S KV M NS ++V+P T + + C +C EC H C CI H Sbjct: 6 VSSLKVNFMINSIISVLPLFTS-EDSKKKTVCQMCDSGEPAQGRCNECDHFVCEQCISAH 64 >SB_18516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 28.7 bits (61), Expect = 4.3 Identities = 18/60 (30%), Positives = 25/60 (41%) Frame = +1 Query: 247 ISDKKVVKMDNSNVAVVPQRTLLGEVNEHITCPLCXGYYIXATTIVECLHSFCRSCIIKH 426 +S KV M NS ++V+P T + + C +C EC H C CI H Sbjct: 85 VSSLKVNFMINSIISVLPLLTS-EDSKKKTVCQMCDSGDPAQGRCNECDHFVCEQCISAH 143 >SB_11042| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00013) Length = 499 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 334 ITCPLCXGYYIXATTIV-ECLHSFCRSCIIKHLKAKSYCPVCEMMI 468 + C +C G + +T +V +C FC CI L+ C C ++ Sbjct: 330 LVCSICMG--VPSTPVVTQCDQIFCSGCITAWLRNAGACSSCRSVL 373 >SB_39497| Best HMM Match : zf-C3HC4 (HMM E-Value=5.1e-12) Length = 558 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 379 IVECLHSFCRSCIIKHLKAKSYCPVCEMMI 468 IV C H F + C+ L + CP+C + I Sbjct: 229 IVPCRHEFHKECVDPWLLSNFTCPLCMLNI 258 >SB_13966| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = +1 Query: 340 CPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVC 456 C LC CLHSF + C + + + CP+C Sbjct: 74 CNLCSRPLDLPAVHFLCLHSFHQPCFEGYAENDNECPIC 112 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 28.3 bits (60), Expect = 5.7 Identities = 11/42 (26%), Positives = 15/42 (35%) Frame = +1 Query: 343 PLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMI 468 P C + C H FC CI + CP+C + Sbjct: 484 PTCQVKLAKQIMLRTCKHIFCEDCISLWFDREQTCPMCRARV 525 >SB_41628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 690 Score = 28.3 bits (60), Expect = 5.7 Identities = 19/78 (24%), Positives = 35/78 (44%), Gaps = 3/78 (3%) Frame = +1 Query: 340 CPLCXGYYIX--ATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMINSAKPNIKLDKALQD 513 C +C G + T ++ C HSFC C +LK++ + + P D L + Sbjct: 312 CGICFGDFRENKMTALMSCGHSFCTECWEFYLKSQ----ISRGEGDIGCPGYNCDVTLDN 367 Query: 514 I-VYKLVPGLFQKEMERR 564 + + L P + K ++R+ Sbjct: 368 VTIMSLTPSWYPKFLKRK 385 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,117,128 Number of Sequences: 59808 Number of extensions: 389299 Number of successful extensions: 938 Number of sequences better than 10.0: 116 Number of HSP's better than 10.0 without gapping: 860 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 930 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -