BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_P23 (650 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protei... 33 0.008 DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protei... 33 0.008 AY344819-1|AAR02430.1| 257|Anopheles gambiae CP5039 protein. 25 1.6 AY344818-1|AAR02429.1| 257|Anopheles gambiae CP5039 protein. 25 1.6 AY344817-1|AAR02428.1| 257|Anopheles gambiae CP5039 protein. 25 1.6 AY344816-1|AAR02427.1| 257|Anopheles gambiae CP5039 protein. 25 1.6 AY344815-1|AAR02426.1| 257|Anopheles gambiae CP5039 protein. 25 1.6 AY344822-1|AAR02433.1| 257|Anopheles gambiae CP5039 protein. 25 2.7 AY344821-1|AAR02432.1| 257|Anopheles gambiae CP5039 protein. 25 2.7 AY344820-1|AAR02431.1| 257|Anopheles gambiae CP5039 protein. 25 2.7 >DQ230894-1|ABD94313.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 33.1 bits (72), Expect = 0.008 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = +1 Query: 340 CPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMIN 471 C +C ++ + +C H FC C + K S C +C + N Sbjct: 247 CYVCRESFVDPI-VTKCKHYFCERCALAQYKKSSRCAICGVQTN 289 >DQ230893-1|ABD94311.1| 315|Anopheles gambiae zinc finger protein 183 protein. Length = 315 Score = 33.1 bits (72), Expect = 0.008 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = +1 Query: 340 CPLCXGYYIXATTIVECLHSFCRSCIIKHLKAKSYCPVCEMMIN 471 C +C ++ + +C H FC C + K S C +C + N Sbjct: 247 CYVCRESFVDPI-VTKCKHYFCERCALAQYKKSSRCAICGVQTN 289 >AY344819-1|AAR02430.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 25.4 bits (53), Expect = 1.6 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -2 Query: 487 YWVLPNLSSFHIQDSSSL 434 YW +P L +FH+ ++ L Sbjct: 225 YWTMPQLETFHVDNNRHL 242 >AY344818-1|AAR02429.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 25.4 bits (53), Expect = 1.6 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -2 Query: 487 YWVLPNLSSFHIQDSSSL 434 YW +P L +FH+ ++ L Sbjct: 225 YWTMPQLETFHVDNNRHL 242 >AY344817-1|AAR02428.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 25.4 bits (53), Expect = 1.6 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -2 Query: 487 YWVLPNLSSFHIQDSSSL 434 YW +P L +FH+ ++ L Sbjct: 225 YWTMPQLETFHVDNNRHL 242 >AY344816-1|AAR02427.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 25.4 bits (53), Expect = 1.6 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -2 Query: 487 YWVLPNLSSFHIQDSSSL 434 YW +P L +FH+ ++ L Sbjct: 225 YWTMPQLETFHVDNNRHL 242 >AY344815-1|AAR02426.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 25.4 bits (53), Expect = 1.6 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -2 Query: 487 YWVLPNLSSFHIQDSSSL 434 YW +P L +FH+ ++ L Sbjct: 225 YWTMPQLETFHVDNNRHL 242 >AY344822-1|AAR02433.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 24.6 bits (51), Expect = 2.7 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -2 Query: 487 YWVLPNLSSFHIQDS 443 YW +P L +FH+ ++ Sbjct: 225 YWTMPQLETFHVDNN 239 >AY344821-1|AAR02432.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 24.6 bits (51), Expect = 2.7 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -2 Query: 487 YWVLPNLSSFHIQDS 443 YW +P L +FH+ ++ Sbjct: 225 YWTMPQLETFHVDNN 239 >AY344820-1|AAR02431.1| 257|Anopheles gambiae CP5039 protein. Length = 257 Score = 24.6 bits (51), Expect = 2.7 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -2 Query: 487 YWVLPNLSSFHIQDS 443 YW +P L +FH+ ++ Sbjct: 225 YWTMPQLETFHVDNN 239 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 657,908 Number of Sequences: 2352 Number of extensions: 11776 Number of successful extensions: 30 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -