BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_P18 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 24 1.1 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 24 1.1 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 1.5 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 22 6.0 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/54 (22%), Positives = 29/54 (53%) Frame = -3 Query: 540 EHGLDGDVHGGRVECFEHDLGHXLSVGLGVEGSLSEQDWVFLGGDTQLIVEGMM 379 +HG+ + GG ++C + +++ E + + + + L GD + +VEG++ Sbjct: 271 KHGIVIEELGGEIQCVKISALKGINLRELTEAIIVQAELMDLKGDLEGLVEGVI 324 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 24.2 bits (50), Expect = 1.1 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 99 LKTNSTMCDEEVAALVVDNGSGMCKAGFAGD 191 LK ++ + D++ + D GMCK G +GD Sbjct: 111 LKLDNVLLDQDGHIKIAD--FGMCKEGISGD 139 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -1 Query: 257 PTITALMAGPSHDRGEHGARSIISCETGLA 168 P +T + + D GEH ++ E GLA Sbjct: 118 PDVTTVELVDATDPGEHNGDTVTDVEAGLA 147 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.8 bits (44), Expect = 6.0 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -3 Query: 603 VGDTVAGVQHDTGGTTXRVQREHGLDGDVHG 511 VGD +A ++ D G + E+G G G Sbjct: 42 VGDDIAWMKFDKEGRLRAINPEYGFFGVAPG 72 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,422 Number of Sequences: 438 Number of extensions: 4678 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -