BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_P14 (534 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13A11.05 |||peptidase family M17|Schizosaccharomyces pombe|c... 26 3.1 SPBC2D10.18 |abc1|coq8|ABC1 kinase family protein|Schizosaccharo... 26 4.1 >SPAC13A11.05 |||peptidase family M17|Schizosaccharomyces pombe|chr 1|||Manual Length = 513 Score = 26.2 bits (55), Expect = 3.1 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +2 Query: 110 FAAVYCKETYSSENDDL-DIEALVGNIDSLKAFIGCFL 220 F Y K+ SS N DL ++ G + AFI CFL Sbjct: 433 FHEAYLKQLTSSSNADLCNVSRAGGGCCTAAAFIKCFL 470 >SPBC2D10.18 |abc1|coq8|ABC1 kinase family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 610 Score = 25.8 bits (54), Expect = 4.1 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 74 KMKGFYVLCFALFAAVYCKETYS 142 ++ G ++LC L A V CKE +S Sbjct: 580 RLSGHFLLCAKLGAKVRCKELFS 602 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,062,960 Number of Sequences: 5004 Number of extensions: 38597 Number of successful extensions: 98 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 220420454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -