BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_P14 (534 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g01680.1 68418.m00085 cation/hydrogen exchanger, putative (CH... 28 4.5 >At5g01680.1 68418.m00085 cation/hydrogen exchanger, putative (CHX26) monovalent cation:proton antiporter family 2 (CPA2) member, PMID:11500563 Length = 780 Score = 27.9 bits (59), Expect = 4.5 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -2 Query: 467 KIKN*FP*ELATADNRASKCFXWGSYLVLKA--SYX*GSLSLTTFKETF 327 K+ N P LA + + CF WG +L+L S+ + S TT+ TF Sbjct: 192 KMLNSEPGRLALSSIMVANCFGWGFFLLLITFDSFLHQNYSKTTYLPTF 240 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,590,771 Number of Sequences: 28952 Number of extensions: 196253 Number of successful extensions: 447 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 441 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 447 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 984125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -