BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_P12 (652 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC962.02c |bir1|cut17, pbh1, SPCP31B10.10c|survivin homolog|Sc... 48 9e-07 SPBC530.08 |||transcription factor |Schizosaccharomyces pombe|ch... 27 1.8 SPAC1006.04c |mcp3|mug7|sequence orphan|Schizosaccharomyces pomb... 25 9.5 >SPCC962.02c |bir1|cut17, pbh1, SPCP31B10.10c|survivin homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 997 Score = 48.4 bits (110), Expect = 9e-07 Identities = 29/80 (36%), Positives = 36/80 (45%), Gaps = 10/80 (12%) Frame = +3 Query: 357 DMRREEERLKTFDQ--WPVTFLTPEQLARNGFYYLG--------RGDEVCCAFCKVXIMR 506 +M +RL TF + WP TPE LA GFYY R D V C C Sbjct: 18 EMCNYSKRLDTFQKKKWPRAKPTPETLATVGFYYNPISESNSEERLDNVTCYMCTKSFYD 77 Query: 507 WVEGDDPAADHRRWAPQCPF 566 W + DDP +H +P CP+ Sbjct: 78 WEDDDDPLKEHITHSPSCPW 97 Score = 35.9 bits (79), Expect = 0.005 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 3/52 (5%) Frame = +3 Query: 420 PEQLARNGFYY---LGRGDEVCCAFCKVXIMRWVEGDDPAADHRRWAPQCPF 566 P +A +GF Y D C +C + + W DDP +H+R C F Sbjct: 141 PSVMAASGFVYNPTADAKDAAHCLYCDINLHDWEPDDDPYTEHKRRRADCVF 192 >SPBC530.08 |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 815 Score = 27.5 bits (58), Expect = 1.8 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -3 Query: 218 IPRIF*HHQRGGSSIFSNFRQLQLVYFSFFLVTHK 114 +PR+F Q G F LQLVY+SF ++ ++ Sbjct: 469 LPRVFRAEQPGEFQANHFFYNLQLVYYSFRMLIYR 503 >SPAC1006.04c |mcp3|mug7|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 952 Score = 25.0 bits (52), Expect = 9.5 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -3 Query: 500 NXYLTESTAHLVAATEVVESVAGQLFRRQKRNGPLIKCFQTFL 372 N L+E AHL A + E + QL + + L+ +Q+F+ Sbjct: 563 NSKLSEGRAHLETANKENEILKQQLELSESKLASLLNSYQSFI 605 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,374,716 Number of Sequences: 5004 Number of extensions: 45290 Number of successful extensions: 82 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -