BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_P07 (652 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 27 0.18 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 25 0.41 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 25 0.41 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.7 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 6.7 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 26.6 bits (56), Expect = 0.18 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -1 Query: 154 LVMLISICKSVLLYIIFVTFYILLVNN 74 L++ I+I VLL ++VT YI+L NN Sbjct: 217 LLVFITINFVVLLGDLYVTLYIILTNN 243 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 25.4 bits (53), Expect = 0.41 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 407 IQLHVLTHPNMTVFRKCDLDNSIP 478 + HV +HPN+T +++C N P Sbjct: 188 VVFHVESHPNITWYQQCVTYNVFP 211 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 25.4 bits (53), Expect = 0.41 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 407 IQLHVLTHPNMTVFRKCDLDNSIP 478 + HV +HPN+T +++C N P Sbjct: 188 VVFHVESHPNITWYQQCVTYNVFP 211 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 6.7 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = -2 Query: 408 IRGSPRYWQHVRSEQRTSNNLHGKTVIRWHFNEYT 304 + G P Y Q R E+ ++ L+ K EYT Sbjct: 1637 VMGMPLYGQSFRLEKPENHGLNAKAPGPGQAGEYT 1671 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 Query: 337 NSHQVAFQ*IYFFFTL 290 NS+ AF I+FFF + Sbjct: 65 NSYMYAFTHIFFFFAI 80 Score = 21.0 bits (42), Expect = 8.8 Identities = 10/39 (25%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = -1 Query: 151 VMLISICKSVLLY---IIFVTFYILLVNNSIFVLSKTYC 44 V+ + + K+ +++ I+F+ F+ + + IF L YC Sbjct: 124 VIFVVLSKNGIVFAGLIVFILFFAQGLTSPIFNLVYVYC 162 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,953 Number of Sequences: 336 Number of extensions: 3293 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -