BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_P07 (652 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0270 - 13613853-13614153,13614233-13614403,13614486-136153... 33 0.26 06_01_0289 - 2111768-2114377,2114970-2115025,2115272-2115323 30 1.4 >06_02_0270 - 13613853-13614153,13614233-13614403,13614486-13615318, 13615401-13615746,13615940-13616127,13616238-13616408 Length = 669 Score = 32.7 bits (71), Expect = 0.26 Identities = 27/80 (33%), Positives = 38/80 (47%), Gaps = 3/80 (3%) Frame = -2 Query: 609 TMFSSSRRRQFRPTTLSISSVHMNLRSRTTRRLNFERVSIQNGWGIELSR---SHLRKTV 439 T +S RRQ+ P + M+L R LN E ++ G G++ +R SHLR V Sbjct: 55 TEAGTSARRQYGPKKMQPLQQQMSL-PRFQTSLNKE-LATGCGQGVKSTRTALSHLRTKV 112 Query: 438 MLGCVNTWS*IRGSPRYWQH 379 ML + W GS W+H Sbjct: 113 MLSSIRNWG--IGSDVPWKH 130 >06_01_0289 - 2111768-2114377,2114970-2115025,2115272-2115323 Length = 905 Score = 30.3 bits (65), Expect = 1.4 Identities = 21/55 (38%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +2 Query: 380 CCQYRGDPRIQLHVLTHPNMTVFRKCDLDN---SIPQPFWIETLSKFSRLVVLDL 535 C + P L+ L+H N T R DL + S P WI SK S L LDL Sbjct: 226 CLNHAFLPATDLNALSHTNFTAIRVLDLKSNNFSSRMPDWI---SKLSSLAYLDL 277 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,082,699 Number of Sequences: 37544 Number of extensions: 290750 Number of successful extensions: 702 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 702 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -