BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_O21 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 25 0.48 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 24 1.5 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 24 1.5 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 24 1.5 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 22 4.5 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 22 4.5 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 6.0 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 7.9 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 25.4 bits (53), Expect = 0.48 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = -2 Query: 274 NRSNGTVLKPKLDFXMCHCGFASSYVQVELYNRKKYNILL 155 N NG +L P + +C G+ + ++YN ++ L+ Sbjct: 358 NDGNGNILSPSIHDNICSNGWICEHRWRQIYNMVRFRNLV 397 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 204 ELAKPQ*HIXKSSLGFSTVPLLLFNVRXLKV 296 +L + Q ++ SSLG +PLLL ++ L++ Sbjct: 189 QLTRRQGYVIYSSLGSFFIPLLLMSLVYLEI 219 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 204 ELAKPQ*HIXKSSLGFSTVPLLLFNVRXLKV 296 +L + Q ++ SSLG +PLLL ++ L++ Sbjct: 189 QLTRRQGYVIYSSLGSFFIPLLLMSLVYLEI 219 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 204 ELAKPQ*HIXKSSLGFSTVPLLLFNVRXLKV 296 +L + Q ++ SSLG +PLLL ++ L++ Sbjct: 189 QLTRRQGYVIYSSLGSFFIPLLLMSLVYLEI 219 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = -1 Query: 338 LLPKKLFSXILGFCHLEXPD 279 LL +K++ + G+C + PD Sbjct: 357 LLREKIYGALEGYCRVAWPD 376 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 22.2 bits (45), Expect = 4.5 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = -1 Query: 338 LLPKKLFSXILGFCHLEXPD 279 LL +K++ + G+C + PD Sbjct: 357 LLREKIYGALEGYCRVAWPD 376 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = -2 Query: 220 CGFASSYVQVELYNRKKYNILLLHQLNI 137 C ++++Y Y + YNI + Q+ I Sbjct: 311 CNYSNNYYNNNNYKKLYYNINYIEQIPI 338 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 71 VNQNLYELFNSKYLSQFLQLVS 6 VN +Y +FN ++ F +LVS Sbjct: 672 VNPVIYTVFNPEFRKAFHKLVS 693 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,864 Number of Sequences: 438 Number of extensions: 3804 Number of successful extensions: 14 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -