BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_O19 (655 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79470.1 68414.m09262 inosine-5'-monophosphate dehydrogenase ... 93 1e-19 At1g16350.1 68414.m01956 inosine-5'-monophosphate dehydrogenase,... 93 1e-19 At3g58360.1 68416.m06505 meprin and TRAF homology domain-contain... 29 3.6 At3g30390.1 68416.m03836 amino acid transporter family protein l... 28 6.2 >At1g79470.1 68414.m09262 inosine-5'-monophosphate dehydrogenase identical to inosine-5'-monophosphate dehydrogenase SP|P47996 {Arabidopsis thaliana} Length = 503 Score = 93.1 bits (221), Expect = 1e-19 Identities = 45/111 (40%), Positives = 65/111 (58%) Frame = +1 Query: 310 LRXGLSAEDTFANSEGLTYNDFLLLPGYIDFTAEEVDLTSPLTKKILLKAPLVSTPMDTV 489 L G A+ FA TY+D + LP +IDF+ + V L++ L++++ L P VS+PMDTV Sbjct: 4 LEDGFPADKLFAQGYSYTYDDVIFLPHFIDFSTDAVSLSTRLSRRVPLSIPCVSSPMDTV 63 Query: 490 TEADMAISMALCGGIGIIHHNCTPEYQANEXHKVXKYKHGFIXDPVCMGPE 642 +E+ MA +MA GGIGI+H+NC QA+ + KH D PE Sbjct: 64 SESHMAAAMASLGGIGIVHYNCGIAAQASIIRQAKSLKHPIASDAGVKFPE 114 >At1g16350.1 68414.m01956 inosine-5'-monophosphate dehydrogenase, putative strong similarity to SP|P47996 gb|L34684 inosine monophosphate dehydrogenase (IMPDH) from Arabidopsis thaliana; member of the PF|00478 IMP dehydrogenase family Length = 502 Score = 93.1 bits (221), Expect = 1e-19 Identities = 44/111 (39%), Positives = 67/111 (60%) Frame = +1 Query: 319 GLSAEDTFANSEGLTYNDFLLLPGYIDFTAEEVDLTSPLTKKILLKAPLVSTPMDTVTEA 498 G SAE F+ TY+D + LP +IDF+ + V L++ L+K++ L P V++PMDTV+E+ Sbjct: 7 GFSAEKLFSQGYSYTYDDVIFLPHFIDFSTDAVSLSTRLSKRVPLSIPCVASPMDTVSES 66 Query: 499 DMAISMALCGGIGIIHHNCTPEYQANEXHKVXKYKHGFIXDPVCMGPENTV 651 MA +MA GGIGI+H+NC + QA+ + D V PE+ + Sbjct: 67 HMAAAMAALGGIGIVHYNCDIDTQASVIRHAKSLQVPIASDAVFKCPEHQI 117 >At3g58360.1 68416.m06505 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 298 Score = 28.7 bits (61), Expect = 3.6 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +1 Query: 328 AEDTFANSEGLTYNDFLLLPGYIDFTAEEVDLTSPLTKKILLKAP 462 +E+T E + +N F LLP +DF + + + LK P Sbjct: 143 SEETSTIMESMDFNGFQLLPSQVDFVRHMFEKHPEIASEFRLKNP 187 >At3g30390.1 68416.m03836 amino acid transporter family protein low similarity to neuronal glutamine transporter [Rattus norvegicus] GI:6978016; belongs to INTERPRO:IPR002422 amino acid/polyamine transporter, family II Length = 460 Score = 27.9 bits (59), Expect = 6.2 Identities = 18/49 (36%), Positives = 27/49 (55%) Frame = +3 Query: 153 LLKDNYHVWIFSRETTLPAFLITLPVLVNQIKSDLXXKYITYEKNVIKD 299 +LKD H +R+TTL F+I L VL N I + Y ++KN ++ Sbjct: 414 ILKDR-HDKATNRDTTLAIFMIVLAVLSNAI-AIYSDAYALFKKNAPRE 460 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,410,486 Number of Sequences: 28952 Number of extensions: 228553 Number of successful extensions: 625 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -