BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_O16 (444 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23131| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.24 SB_51975| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_7587| Best HMM Match : zf-C2H2 (HMM E-Value=3.5e-13) 28 3.0 SB_59058| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_57006| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_46539| Best HMM Match : Keratin_B2 (HMM E-Value=1.2) 27 5.3 SB_56509| Best HMM Match : Ebp2 (HMM E-Value=2.1) 27 5.3 SB_34877| Best HMM Match : Methyltransf_2 (HMM E-Value=0.00017) 27 7.0 SB_38395| Best HMM Match : TAFII28 (HMM E-Value=2.9) 27 9.2 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_23131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 31.9 bits (69), Expect = 0.24 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +1 Query: 7 LSTFVSERFTKMAKR---TKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTC 156 +ST S + K+ R T+ GIT T Y +S +K+V + T+ A TC Sbjct: 1 MSTHYSSPYKKLVPRQLTTRWSGITCMMSTHYSSSYKKLVPRQLTTRWASITC 53 Score = 28.3 bits (60), Expect = 3.0 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +1 Query: 7 LSTFVSERFTKMAKR---TKKVGITGKYGTRYGASLRKMVKKMEVTQHAKYTC 156 +ST S + K+ R T+ IT T Y +S +K+V + T+ + TC Sbjct: 28 MSTHYSSSYKKLVPRQLTTRWASITCMMSTHYSSSYKKLVPRSLTTRWSGITC 80 >SB_51975| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 809 Score = 28.7 bits (61), Expect = 2.3 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 27 EVYQNGQTYQKGWNYWQIWHTLRCL 101 + YQ + GW WQIW LR + Sbjct: 644 DTYQGRPLMKYGWLKWQIWRALRLI 668 >SB_7587| Best HMM Match : zf-C2H2 (HMM E-Value=3.5e-13) Length = 351 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 94 GASLRKMVKKMEVTQHAKYTCSFCGK 171 G +K ++ E++ H KY CS CGK Sbjct: 210 GGVTKKQIQSNEIS-HKKYVCSTCGK 234 >SB_59058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 377 Score = 27.9 bits (59), Expect = 4.0 Identities = 14/76 (18%), Positives = 31/76 (40%) Frame = -2 Query: 326 VYYLNYFTSRNLLTADLHDEAAVVENTQAPPATVLLHRLQDQMPTQERFIASLPQNEQVY 147 + + + F N A + + V + +L+ +++ AS + E + Sbjct: 122 ILHHSIFWGNNFWFAAVTPPSDVTNKPSSASRGLLVLLFSQAAALRKKIAASCWEKESEF 181 Query: 146 FACWVTSIFLTILRRE 99 + CWV S F+T + + Sbjct: 182 YECWVASFFITTAKTQ 197 >SB_57006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 604 Score = 27.5 bits (58), Expect = 5.3 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 173 SLPQNEQVYFACWVTSIFLTIL 108 S P + V FA W SIFLTI+ Sbjct: 133 SAPTSLSVIFAAWFLSIFLTII 154 >SB_46539| Best HMM Match : Keratin_B2 (HMM E-Value=1.2) Length = 300 Score = 27.5 bits (58), Expect = 5.3 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +3 Query: 156 LILW*GCYETFL-CRHLVL*AMQEDCSRRSLGILHYCCLIMQICCQEV 296 ++L GCY L C H+V M C + +L C++M ICC +V Sbjct: 127 VVLSLGCYVVMLLCHHVV---MSLSCY---IDMLLCRCVVMSICCYDV 168 >SB_56509| Best HMM Match : Ebp2 (HMM E-Value=2.1) Length = 298 Score = 27.5 bits (58), Expect = 5.3 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +1 Query: 151 TCSFCGKDAMKRS 189 TC+FCGKDA K S Sbjct: 243 TCNFCGKDARKTS 255 >SB_34877| Best HMM Match : Methyltransf_2 (HMM E-Value=0.00017) Length = 893 Score = 27.1 bits (57), Expect = 7.0 Identities = 15/56 (26%), Positives = 21/56 (37%) Frame = -2 Query: 281 DLHDEAAVVENTQAPPATVLLHRLQDQMPTQERFIASLPQNEQVYFACWVTSIFLT 114 D H V EN + T RL D + + + + + VYF FLT Sbjct: 670 DKHSAEHVAENVKPSCKTGSTRRLLDTLVAMQLLVKEMDSDPPVYFNSQTAEAFLT 725 >SB_38395| Best HMM Match : TAFII28 (HMM E-Value=2.9) Length = 292 Score = 26.6 bits (56), Expect = 9.2 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 Query: 290 LTADLHDEAAVVENTQAP 237 +TADLHD A VV N + P Sbjct: 247 ITADLHDTARVVVNLRTP 264 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 26.6 bits (56), Expect = 9.2 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 Query: 290 LTADLHDEAAVVENTQAP 237 +TADLHD A VV N + P Sbjct: 972 ITADLHDTARVVVNLRTP 989 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,105,196 Number of Sequences: 59808 Number of extensions: 232783 Number of successful extensions: 645 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 617 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 645 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 871599479 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -