BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_O15 (610 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 219 1e-59 DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein ... 24 1.3 AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein ... 24 1.3 DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 22 4.1 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 22 4.1 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 22 5.4 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 22 5.4 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 22 5.4 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 7.1 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 7.1 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 7.1 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 21 7.1 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 21 9.4 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 21 9.4 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 21 9.4 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 21 9.4 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 219 bits (536), Expect = 1e-59 Identities = 106/154 (68%), Positives = 116/154 (75%) Frame = +1 Query: 70 GNVRPYARRGSMS*GVPLQTPGSALSESTPXRSRGGNTKYRALRLDTGNFSWGSECSTRK 249 G +P ++ G P R+RGGN KYRALRLDTGNFSWGSEC+TRK Sbjct: 16 GKRKPIRKKRKFELGRPAANTKLGPQRIHTVRTRGGNKKYRALRLDTGNFSWGSECTTRK 75 Query: 250 TRIIDVVYNASNNELVRTKTLVKNAIVVVDATPFRQWYESHYTLPLGRKKGAKLTEAEEA 429 TRIIDVVYNASNNELVRTKTLVKNAIV +DATPFRQWYE HY LPLGRK+GAKLTEAEE Sbjct: 76 TRIIDVVYNASNNELVRTKTLVKNAIVTIDATPFRQWYEGHYVLPLGRKRGAKLTEAEEE 135 Query: 430 IINXKRSQKTARKYLARQRLAKVEGALXEQFHTG 531 ++N KRS+K KY ARQR AKVE AL EQF TG Sbjct: 136 VLNKKRSKKAEAKYKARQRFAKVEPALEEQFATG 169 Score = 61.3 bits (142), Expect = 7e-12 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 69 GKRAPIRKKRKYELGRPAANTRLGPQRIHS 158 GKR PIRKKRK+ELGRPAANT+LGPQRIH+ Sbjct: 16 GKRKPIRKKRKFELGRPAANTKLGPQRIHT 45 Score = 54.4 bits (125), Expect = 8e-10 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = +2 Query: 530 GRLLACVASRPGQCGRADGYILXGKEL 610 GR+LAC++SRPGQCGR DGYIL GKEL Sbjct: 169 GRVLACISSRPGQCGREDGYILEGKEL 195 Score = 39.1 bits (87), Expect = 3e-05 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 23 MGISRDHWHKRRATG 67 MGISRDHWHKRRATG Sbjct: 1 MGISRDHWHKRRATG 15 >DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein 4 protein. Length = 128 Score = 23.8 bits (49), Expect = 1.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 333 YNNCILDKGLCT 298 Y NC+LD+G CT Sbjct: 46 YVNCLLDQGPCT 57 >AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein protein. Length = 128 Score = 23.8 bits (49), Expect = 1.3 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 333 YNNCILDKGLCT 298 Y NC+LD+G CT Sbjct: 46 YVNCLLDQGPCT 57 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 22.2 bits (45), Expect = 4.1 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 333 YNNCILDKGLCTHQ 292 Y C+LD+G CT++ Sbjct: 43 YIKCMLDEGPCTNE 56 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 22.2 bits (45), Expect = 4.1 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 333 YNNCILDKGLCTHQ 292 Y C+LD+G CT++ Sbjct: 43 YIKCMLDEGPCTNE 56 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 366 LIPLPEWSCIYYNNC 322 L P P+WS Y++C Sbjct: 104 LQPYPDWSFAKYDDC 118 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 366 LIPLPEWSCIYYNNC 322 L P P+WS Y++C Sbjct: 104 LQPYPDWSFAKYDDC 118 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 5.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 366 LIPLPEWSCIYYNNC 322 L P P+WS Y++C Sbjct: 104 LQPYPDWSFAKYDDC 118 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 366 LIPLPEWSCIYYNNC 322 L P P+WS Y +C Sbjct: 109 LQPYPDWSFAKYEDC 123 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 366 LIPLPEWSCIYYNNC 322 L P P+WS Y +C Sbjct: 110 LRPYPDWSFAKYEDC 124 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 366 LIPLPEWSCIYYNNC 322 L P P+WS Y +C Sbjct: 108 LQPYPDWSWANYKDC 122 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 366 LIPLPEWSCIYYNNC 322 L P P+WS Y +C Sbjct: 108 LQPYPDWSWANYKDC 122 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -2 Query: 333 YNNCILDKGLCT 298 Y C++D+G CT Sbjct: 47 YFKCLMDEGRCT 58 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = +1 Query: 244 RKTRIIDVVYNASNNELVRTKTLVKNAIVVVDATPFRQ 357 RK + +VVY N + + V + I ++ A+P ++ Sbjct: 358 RKRPMHNVVYRPGENPVTQRLPAVLSRIGIILASPLKR 395 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -2 Query: 333 YNNCILDKGLCT 298 Y C++D+G CT Sbjct: 47 YFKCLMDEGRCT 58 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 21.0 bits (42), Expect = 9.4 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -2 Query: 333 YNNCILDKGLCT 298 Y C++D+G CT Sbjct: 47 YFKCLMDEGRCT 58 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,181 Number of Sequences: 438 Number of extensions: 3342 Number of successful extensions: 19 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -