BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_O12 (618 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC622.12c |||NADP-specific glutamate dehydrogenase |Schizosacc... 33 0.044 SPAC323.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 27 2.9 SPBC3B8.04c |||membrane transporter|Schizosaccharomyces pombe|ch... 26 5.0 SPCC1827.07c ||SPCP1E11.01c|SPX/EXS domain protein|Schizosacchar... 26 5.0 SPAC30.04c |abc4||glutathione S-conjugate-exporting ATPase Abc4|... 25 8.8 SPAC1805.12c |uep1|ubi2|ribosomal-ubiquitin fusion protein Ubi2|... 25 8.8 SPAC11G7.04 |ubi1||ribosomal-ubiquitin fusion protein Ubi1|Schiz... 25 8.8 >SPCC622.12c |||NADP-specific glutamate dehydrogenase |Schizosaccharomyces pombe|chr 3|||Manual Length = 451 Score = 32.7 bits (71), Expect = 0.044 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = +1 Query: 430 ILKLMEPCDHILEIQFPLRRDSGDYEMILXYRAQHSTHRTPTKGGIRFSTDVTRDEVKAL 609 +L ++ + +LE + D G+ + YR Q ++ P KGG+RF V +K L Sbjct: 35 VLPIISIPERVLEFRVTWEDDKGNCRVNTGYRVQFNSALGPYKGGLRFHPSVNLSILKFL 94 >SPAC323.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 575 Score = 26.6 bits (56), Expect = 2.9 Identities = 8/13 (61%), Positives = 12/13 (92%) Frame = +1 Query: 451 CDHILEIQFPLRR 489 CDHI+ +Q+PL+R Sbjct: 120 CDHIVNLQYPLKR 132 >SPBC3B8.04c |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 867 Score = 25.8 bits (54), Expect = 5.0 Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = +2 Query: 392 GHPLKXRKXK*PVF*NLWNHAITFLRFNFL*GAILAITK*YXAIAHNI-PHTGLQPKEV 565 G PL ++ +F ++WN I L F A L+ +A +I H G +P+ V Sbjct: 474 GSPLSGKESTKVIFSSMWNPTIVLLLGGFTIAAALSKYHIAKRLATSILAHAGRKPRSV 532 >SPCC1827.07c ||SPCP1E11.01c|SPX/EXS domain protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 682 Score = 25.8 bits (54), Expect = 5.0 Identities = 10/29 (34%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -3 Query: 553 LESCVWNVVRDSXISFRNRQN-RASEEIE 470 + C+WN++R NR+N RA+ E++ Sbjct: 612 MRRCMWNILRVEHEEIYNRENLRAARELK 640 >SPAC30.04c |abc4||glutathione S-conjugate-exporting ATPase Abc4|Schizosaccharomyces pombe|chr 1|||Manual Length = 1469 Score = 25.0 bits (52), Expect = 8.8 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -1 Query: 267 LMTSVCAAADIHSSWYDSEHCIEGFIL 187 LM V +A DIH+S + +HC + ++ Sbjct: 762 LMDDVFSALDIHTSNWIYKHCFQSSLM 788 >SPAC1805.12c |uep1|ubi2|ribosomal-ubiquitin fusion protein Ubi2|Schizosaccharomyces pombe|chr 1|||Manual Length = 128 Score = 25.0 bits (52), Expect = 8.8 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = +3 Query: 294 YKCESEVLPHGRIFFPPSLSSCRRQAC 374 Y CE ++ PP ++CR++ C Sbjct: 89 YNCEKQICRKCYARLPPRATNCRKKKC 115 >SPAC11G7.04 |ubi1||ribosomal-ubiquitin fusion protein Ubi1|Schizosaccharomyces pombe|chr 1|||Manual Length = 128 Score = 25.0 bits (52), Expect = 8.8 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = +3 Query: 294 YKCESEVLPHGRIFFPPSLSSCRRQAC 374 Y CE ++ PP ++CR++ C Sbjct: 89 YNCEKQICRKCYARLPPRATNCRKKKC 115 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,482,222 Number of Sequences: 5004 Number of extensions: 49229 Number of successful extensions: 110 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 271646730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -