BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_O12 (618 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0678 + 27207340-27207447,27207555-27207668,27209111-272093... 45 6e-05 02_05_0144 + 26258841-26258948,26259099-26259212,26259335-262595... 45 6e-05 03_06_0282 - 32824950-32825135,32825247-32825505,32825651-328259... 44 1e-04 01_05_0337 + 21115388-21115961,21116471-21116597,21116683-211168... 32 0.42 10_01_0296 + 3069605-3070535,3071127-3071294,3075307-3076454 31 0.73 03_01_0006 + 65675-65808,66385-66457,68290-68526,68648-68785,688... 28 5.2 07_03_0507 - 18871260-18871361,18871444-18871560,18871792-188721... 28 6.8 >04_04_0678 + 27207340-27207447,27207555-27207668,27209111-27209332, 27209407-27209481,27209569-27209685,27210145-27210395, 27210686-27210761,27210862-27210948,27211037-27211222 Length = 411 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/52 (36%), Positives = 30/52 (57%) Frame = +1 Query: 463 LEIQFPLRRDSGDYEMILXYRAQHSTHRTPTKGGIRFSTDVTRDEVKALSAL 618 ++++ + +D G + +R QH R P KGGIR+ +V DEV AL+ L Sbjct: 35 IKVECTIPKDDGTLASFIGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQL 86 >02_05_0144 + 26258841-26258948,26259099-26259212,26259335-26259556, 26259660-26259734,26259827-26259943,26260046-26260296, 26260833-26260908,26261045-26261131,26261216-26261401 Length = 411 Score = 44.8 bits (101), Expect = 6e-05 Identities = 19/52 (36%), Positives = 30/52 (57%) Frame = +1 Query: 463 LEIQFPLRRDSGDYEMILXYRAQHSTHRTPTKGGIRFSTDVTRDEVKALSAL 618 ++++ + +D G + +R QH R P KGGIR+ +V DEV AL+ L Sbjct: 35 IKVECTIPKDDGTLATFVGFRVQHDNSRGPMKGGIRYHPEVDPDEVNALAQL 86 >03_06_0282 - 32824950-32825135,32825247-32825505,32825651-32825901, 32826309-32826425,32826613-32826687,32826788-32827009, 32827396-32827509,32827694-32827801 Length = 443 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/52 (36%), Positives = 30/52 (57%) Frame = +1 Query: 463 LEIQFPLRRDSGDYEMILXYRAQHSTHRTPTKGGIRFSTDVTRDEVKALSAL 618 ++++ + +D G + +R QH R P KGGIR+ +V DEV AL+ L Sbjct: 35 IKVECTIPKDDGTLASYVGFRVQHDNARGPMKGGIRYHHEVDPDEVNALAQL 86 >01_05_0337 + 21115388-21115961,21116471-21116597,21116683-21116884, 21117460-21117546,21117622-21117681,21117800-21117886, 21118451-21118522,21118675-21118730,21118812-21118897, 21119427-21119517,21119593-21119750,21119827-21119918, 21120110-21120190,21120282-21120479 Length = 656 Score = 31.9 bits (69), Expect = 0.42 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 1/80 (1%) Frame = +1 Query: 376 EDLKSRTPIEXKKXKVAGIL-KLMEPCDHILEIQFPLRRDSGDYEMILXYRAQHSTHRTP 552 E + S P+ K + IL +L+EP + + P D G+ + +R Q S P Sbjct: 220 EVVHSLEPVLVKNSQHVQILERLLEP-ERCFIFRVPWVDDRGEAHVNRGFRVQFSQALGP 278 Query: 553 TKGGIRFSTDVTRDEVKALS 612 +GG+RF +T K L+ Sbjct: 279 CRGGLRFHPSMTLSVAKFLA 298 >10_01_0296 + 3069605-3070535,3071127-3071294,3075307-3076454 Length = 748 Score = 31.1 bits (67), Expect = 0.73 Identities = 20/88 (22%), Positives = 36/88 (40%) Frame = +1 Query: 319 HMVEYFFHRACQVVEDKLVEDLKSRTPIEXKKXKVAGILKLMEPCDHILEIQFPLRRDSG 498 H F + V ED + + + +E K KV + E + ++ ++ + G Sbjct: 642 HSGRAMFDKEIAVEEDIFILEEIGKLAMECLKEKVEERPDMKEVAERLVMLRRARKHGQG 701 Query: 499 DYEMILXYRAQHSTHRTPTKGGIRFSTD 582 Y + + + S TPT G FST+ Sbjct: 702 SYNLSPRHHEEISIETTPTSFGADFSTN 729 >03_01_0006 + 65675-65808,66385-66457,68290-68526,68648-68785, 68871-69005,69131-69310,69495-69701,69821-69943, 70240-70359,70758-70880,72067-72171,72254-72398, 73443-73607,73669-73907,74452-74484,74977-75058, 75200-75360,75739-75951,76789-76971,77051-77220, 77375-77474 Length = 1021 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -3 Query: 598 LHLWLRPLRIEYLLWLESCVWNVVRDSXISFRNRQNRASE 479 ++L L P++ L WN+V D+ ++F NR++ E Sbjct: 905 VYLLLDPMKFAVRYGLSGKAWNLVIDNKVAFTNRKDFGRE 944 >07_03_0507 - 18871260-18871361,18871444-18871560,18871792-18872120, 18872704-18872871,18873592-18873685,18873707-18873766, 18874702-18874762,18875258-18875319,18875729-18875856, 18876783-18876852,18877472-18877630 Length = 449 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -3 Query: 598 LHLWLRPLR-IEYLLWLESCVWNVVRDS 518 LH +LRPL + Y W+ V NV+RD+ Sbjct: 281 LHNFLRPLLFLMYSFWVPQIVTNVIRDT 308 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,219,120 Number of Sequences: 37544 Number of extensions: 317261 Number of successful extensions: 722 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 722 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1490248872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -