BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_O12 (618 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18170.1 68418.m02133 glutamate dehydrogenase 1 (GDH1) identi... 44 6e-05 At3g03910.1 68416.m00405 glutamate dehydrogenase, putative simil... 44 6e-05 At5g07440.1 68418.m00851 glutamate dehydrogenase 2 (GDH2) identi... 44 8e-05 At5g37110.1 68418.m04454 hypothetical protein 28 4.3 At1g51720.1 68414.m05828 glutamate dehydrogenase, putative simil... 28 4.3 At4g01380.1 68417.m00178 plastocyanin-like domain-containing pro... 27 7.5 At2g20650.2 68415.m02422 zinc finger (C3HC4-type RING finger) fa... 27 7.5 At2g20650.1 68415.m02421 zinc finger (C3HC4-type RING finger) fa... 27 7.5 At1g30420.1 68414.m03718 ATP-binding cassette transport protein,... 27 7.5 At5g40910.1 68418.m04967 disease resistance protein (TIR-NBS-LRR... 27 10.0 At5g40470.1 68418.m04908 expressed protein 27 10.0 At4g25040.1 68417.m03592 integral membrane family protein contai... 27 10.0 At2g21300.1 68415.m02535 kinesin motor family protein contains P... 27 10.0 At2g05080.1 68415.m00530 hypothetical protein low similarity to ... 27 10.0 At2g04460.1 68415.m00450 expressed protein 27 10.0 At1g11990.1 68414.m01385 expressed protein contains Pfam PF03138... 27 10.0 >At5g18170.1 68418.m02133 glutamate dehydrogenase 1 (GDH1) identical to glutamate dehydrogenase 1 (GDH 1) [Arabidopsis thaliana] SWISS-PROT:Q43314 Length = 411 Score = 44.4 bits (100), Expect = 6e-05 Identities = 19/52 (36%), Positives = 30/52 (57%) Frame = +1 Query: 463 LEIQFPLRRDSGDYEMILXYRAQHSTHRTPTKGGIRFSTDVTRDEVKALSAL 618 ++++ + +D G + +R QH R P KGGIR+ +V DEV AL+ L Sbjct: 35 IKVECTIPKDDGTLASFVGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQL 86 >At3g03910.1 68416.m00405 glutamate dehydrogenase, putative similar to glutamate dehydrogenase 1 (GDH 1) [Arabidopsis thaliana] SWISS-PROT:Q43314 Length = 411 Score = 44.4 bits (100), Expect = 6e-05 Identities = 19/52 (36%), Positives = 30/52 (57%) Frame = +1 Query: 463 LEIQFPLRRDSGDYEMILXYRAQHSTHRTPTKGGIRFSTDVTRDEVKALSAL 618 ++++ + +D G + +R QH R P KGGIR+ +V DEV AL+ L Sbjct: 35 IKVECTIPKDDGTLASFVGFRVQHDNARGPMKGGIRYHPEVEPDEVNALAQL 86 >At5g07440.1 68418.m00851 glutamate dehydrogenase 2 (GDH2) identical to glutamate dehydrogenase 2 (GDH 2) [Arabidopsis thaliana] SWISS-PROT:Q38946 Length = 411 Score = 44.0 bits (99), Expect = 8e-05 Identities = 19/52 (36%), Positives = 30/52 (57%) Frame = +1 Query: 463 LEIQFPLRRDSGDYEMILXYRAQHSTHRTPTKGGIRFSTDVTRDEVKALSAL 618 ++++ + +D G + +R QH R P KGGIR+ +V DEV AL+ L Sbjct: 35 IKVECTIPKDDGTLVSYIGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQL 86 >At5g37110.1 68418.m04454 hypothetical protein Length = 1307 Score = 28.3 bits (60), Expect = 4.3 Identities = 24/59 (40%), Positives = 30/59 (50%), Gaps = 5/59 (8%) Frame = +1 Query: 259 SHEIPDKLKDIPTSANPKFFHMV-EYFFHRACQVVEDK--LVEDLKSRTP--IEXKKXK 420 S EIPDKLKD P+ F ++ E H C VV K +E+ K RT +E K K Sbjct: 532 SAEIPDKLKD------PELFEVIKESMVHGPCGVVNPKCPCMENGKRRTDDFVEKKDFK 584 >At1g51720.1 68414.m05828 glutamate dehydrogenase, putative similar to NADP-specific glutatamate dehydrogenase (NADP-GDH) SP:P28724 [Giardia lamblia (Giardia intestinalis)] Length = 637 Score = 28.3 bits (60), Expect = 4.3 Identities = 16/58 (27%), Positives = 28/58 (48%) Frame = +1 Query: 436 KLMEPCDHILEIQFPLRRDSGDYEMILXYRAQHSTHRTPTKGGIRFSTDVTRDEVKAL 609 +L+EP + ++ + P D G+ + +R Q + P +GGIRF + K L Sbjct: 238 RLLEP-ERMIVFRVPWIDDRGETHVNRGFRVQFNQALGPCRGGIRFHPSMNLSIAKFL 294 >At4g01380.1 68417.m00178 plastocyanin-like domain-containing protein Length = 210 Score = 27.5 bits (58), Expect = 7.5 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +3 Query: 126 HHAASQEYRQVSGSAAQEFCSK*SPQ--YNVPNHTSW 230 H+ + QVSG+ EFC SP+ YN + SW Sbjct: 38 HNHNLNDVTQVSGALEYEFCDSSSPKAVYNPGHDISW 74 >At2g20650.2 68415.m02422 zinc finger (C3HC4-type RING finger) family protein Length = 559 Score = 27.5 bits (58), Expect = 7.5 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -3 Query: 595 HLWLRP-LRIEYLLWLESCVWNVVRDS 518 H ++RP L + Y W+ V NVVRDS Sbjct: 392 HNYMRPILLLMYSFWIPQIVANVVRDS 418 >At2g20650.1 68415.m02421 zinc finger (C3HC4-type RING finger) family protein Length = 559 Score = 27.5 bits (58), Expect = 7.5 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -3 Query: 595 HLWLRP-LRIEYLLWLESCVWNVVRDS 518 H ++RP L + Y W+ V NVVRDS Sbjct: 392 HNYMRPILLLMYSFWIPQIVANVVRDS 418 >At1g30420.1 68414.m03718 ATP-binding cassette transport protein, putative contains Pfam profiles PF00005: ABC transporter, PF00664: ABC transporter transmembrane region Length = 1488 Score = 27.5 bits (58), Expect = 7.5 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +1 Query: 184 VQNEAL-NTMFRIIPAGVNVCCRTYAS 261 + NE+L N + +P GVN+C YAS Sbjct: 207 LNNESLDNVEYDALPGGVNICPERYAS 233 >At5g40910.1 68418.m04967 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Non-consensus TT donor splice site at exon 1 Length = 1104 Score = 27.1 bits (57), Expect = 10.0 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = -1 Query: 252 CAAADIHSSWYDSEHCIEGFILNRILERRN---H*LGDILEMQH 130 C I + YDS+ C++ +L++IL +++ H LG I E H Sbjct: 238 CFMGTIDVNDYDSKLCLQNKLLSKILNQKDMKIHHLGAIEEWLH 281 >At5g40470.1 68418.m04908 expressed protein Length = 496 Score = 27.1 bits (57), Expect = 10.0 Identities = 8/25 (32%), Positives = 19/25 (76%) Frame = -1 Query: 324 HVEELRIRTCRNIFELIWNLMTSVC 250 ++EE+ +RTCR+I +++ ++ +C Sbjct: 250 NLEEIELRTCRSIVDVVLLKVSEIC 274 >At4g25040.1 68417.m03592 integral membrane family protein contains TIGRFAM TIGR01569 : plant integral membrane protein TIGR01569; contains Pfam PF04535 : Domain of unknown function (DUF588) Length = 170 Score = 27.1 bits (57), Expect = 10.0 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -1 Query: 597 FISGYVR*ESNTSFGWSPVCG 535 F GYV N GW P+CG Sbjct: 113 FAEGYVGKYGNKQAGWLPICG 133 >At2g21300.1 68415.m02535 kinesin motor family protein contains Pfam profile: kinesin motor domain PF00225 Length = 862 Score = 27.1 bits (57), Expect = 10.0 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = -3 Query: 586 LRPLRIEYLLWLESCVWNVVRDSXISFRNRQNRASEEIESQECDRM 449 LRPL + +L E+ W + D+ + +RN S + DR+ Sbjct: 31 LRPLNEKEILANEAADWECINDTTVLYRNTLREGSTFPSAYSFDRV 76 >At2g05080.1 68415.m00530 hypothetical protein low similarity to SP|Q9UUA2 DNA repair and recombination protein pif1, mitochondrial precursor {Schizosaccharomyces pombe} Length = 1238 Score = 27.1 bits (57), Expect = 10.0 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +1 Query: 259 SHEIPDKLKDIPTSANPKFFHMV-EYFFHRACQVVEDK 369 S EIPDKLKD P+ F ++ E H C VV K Sbjct: 399 SAEIPDKLKD------PELFEVIKEMMVHGPCGVVNPK 430 >At2g04460.1 68415.m00450 expressed protein Length = 148 Score = 27.1 bits (57), Expect = 10.0 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -1 Query: 261 TSVCAAADIHSSWYDSEHCIEGFILNRILERR 166 T+V A +++ W ++C +G ILNR++ R Sbjct: 69 TNVYAVGSMNT-WAQGDYCCKGLILNRLVHDR 99 >At1g11990.1 68414.m01385 expressed protein contains Pfam PF03138: Plant protein family. The function of this family of plant proteins is unknown; previously annotated as 'growth regulator protein -related' based on similarity to axi 1 protein (GB:X80301) (GI:559920) from [Nicotiana tabacum], which, due to scienitific fraud was retracted. Retraction in: Schell J. EMBO J 1999 May 17;18(10):2908. PMID:10400497.; expression supported by MPSS Length = 590 Score = 27.1 bits (57), Expect = 10.0 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +3 Query: 405 RXEKXSSRYSKTYGTMRSHS*DSISSEARFWRLRNDIXLSRTTFHTQD 548 + EK +Y+ TYG M S + D+++ R R N + T+D Sbjct: 116 KFEKQKMKYNGTYGRMLSLATDALAEGMRDNRYCNGFDFEQNKLETKD 163 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,985,403 Number of Sequences: 28952 Number of extensions: 257121 Number of successful extensions: 568 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 568 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1246162608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -