BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_O06 (651 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61850.1 68414.m06979 patatin family protein similar to membr... 39 0.003 At2g30100.1 68415.m03663 ubiquitin family protein low similarity... 39 0.003 At3g05660.1 68416.m00630 disease resistance family protein conta... 37 0.013 At3g26500.1 68416.m03305 leucine-rich repeat family protein 36 0.023 At2g17440.1 68415.m02012 leucine-rich repeat family protein cont... 36 0.023 At1g35710.1 68414.m04439 leucine-rich repeat transmembrane prote... 35 0.041 At5g58150.1 68418.m07278 leucine-rich repeat transmembrane prote... 33 0.12 At1g04210.1 68414.m00411 leucine-rich repeat family protein / pr... 33 0.16 At4g20940.1 68417.m03034 leucine-rich repeat family protein cont... 32 0.29 At2g25470.1 68415.m03050 leucine-rich repeat family protein cont... 32 0.29 At5g18360.1 68418.m02160 disease resistance protein (TIR-NBS-LRR... 32 0.38 At3g11330.1 68416.m01378 leucine-rich repeat family protein 32 0.38 At1g66150.1 68414.m07508 leucine-rich repeat protein kinase, put... 31 0.50 At1g58190.1 68414.m06605 leucine-rich repeat family protein cont... 31 0.50 At5g07910.1 68418.m00914 leucine-rich repeat family protein cont... 31 0.66 At2g26330.1 68415.m03159 leucine-rich repeat protein kinase, put... 31 0.66 At1g12970.1 68414.m01506 leucine-rich repeat family protein 31 0.66 At3g15410.1 68416.m01955 leucine-rich repeat family protein cont... 31 0.88 At5g05850.1 68418.m00643 leucine-rich repeat family protein cont... 30 1.2 At4g29450.1 68417.m04204 leucine-rich repeat protein kinase, put... 30 1.2 At3g28040.1 68416.m03500 leucine-rich repeat transmembrane prote... 30 1.2 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 30 1.2 At1g56520.1 68414.m06499 disease resistance protein (TIR-NBS-LRR... 30 1.5 At4g24490.1 68417.m03510 geranylgeranyl transferase alpha subuni... 29 2.0 At5g49290.1 68418.m06100 leucine-rich repeat family protein cont... 29 2.7 At5g44700.1 68418.m05477 leucine-rich repeat transmembrane prote... 29 2.7 At2g17260.1 68415.m01993 glutamate receptor family protein (GLR3... 29 2.7 At4g11170.1 68417.m01809 disease resistance protein (TIR-NBS-LRR... 29 3.5 At4g04220.1 68417.m00598 disease resistance family protein conta... 29 3.5 At4g29880.1 68417.m04252 leucine-rich repeat family protein cont... 28 4.7 At1g25570.1 68414.m03174 leucine-rich repeat protein-related co... 28 4.7 At5g56040.1 68418.m06992 leucine-rich repeat protein kinase, put... 28 6.2 At4g33290.1 68417.m04736 F-box family protein contains Pfam PF00... 28 6.2 At2g24230.1 68415.m02894 leucine-rich repeat transmembrane prote... 28 6.2 At1g64600.1 68414.m07322 expressed protein similar to Hypothetic... 28 6.2 At5g49660.1 68418.m06147 leucine-rich repeat transmembrane prote... 27 8.2 At5g46330.1 68418.m05703 leucine-rich repeat transmembrane prote... 27 8.2 At3g44400.1 68416.m04770 disease resistance protein (TIR-NBS-LRR... 27 8.2 At1g56540.1 68414.m06502 disease resistance protein (TIR-NBS-LRR... 27 8.2 >At1g61850.1 68414.m06979 patatin family protein similar to membrane-associated calcium-independent phospholipase A2 gamma; IPLA2 gamma [Homo sapiens] GI:8453174; contains Patatin domain PF01734, PF00514: Armadillo/beta-catenin-like repeat Length = 1265 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/47 (40%), Positives = 31/47 (65%) Frame = +2 Query: 335 VSVPKIPEWAEQLDLSHNKLNNVTNELNTLSNLKVLKLDXNNMNNIP 475 V V ++P E+L L HNKL+ + E+ L NLK+L++D N + ++P Sbjct: 150 VEVTELP-LLEKLCLEHNKLSVLPPEIGKLKNLKILRVDNNMLISVP 195 >At2g30100.1 68415.m03663 ubiquitin family protein low similarity to SP|Q9UQ13 Leucine-rich repeat protein SHOC-2 (Ras-binding protein Sur-8) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01535: PPR repeat, PF00560: Leucine Rich Repeat Length = 897 Score = 38.7 bits (86), Expect = 0.003 Identities = 15/36 (41%), Positives = 27/36 (75%) Frame = +2 Query: 368 QLDLSHNKLNNVTNELNTLSNLKVLKLDXNNMNNIP 475 QLD+++NKL ++ NEL L+ L++LK + N + ++P Sbjct: 752 QLDVTNNKLTSLPNELGLLTQLEILKANNNRITSLP 787 >At3g05660.1 68416.m00630 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 883 Score = 36.7 bits (81), Expect = 0.013 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +2 Query: 263 GEIYFCPLECACLHLYVDCSKKNLVSVPKIPEWAEQLDLSHNKLN-NVTNELNTLSNLKV 439 GE+ L C+CLH + S NL + + LDLS+N L+ +++ + LS+L Sbjct: 82 GEVIEIDLMCSCLHGWFH-SNSNLSMLQNF-HFLTTLDLSYNHLSGQISSSIGNLSHLTT 139 Query: 440 LKLDXNNMN 466 L L NN + Sbjct: 140 LDLSGNNFS 148 >At3g26500.1 68416.m03305 leucine-rich repeat family protein Length = 471 Score = 35.9 bits (79), Expect = 0.023 Identities = 18/61 (29%), Positives = 37/61 (60%), Gaps = 4/61 (6%) Frame = +2 Query: 305 LYVDCSKKNLVSVP----KIPEWAEQLDLSHNKLNNVTNELNTLSNLKVLKLDXNNMNNI 472 +Y++ S +L +P K+ + E+LD+S N L ++ + + L NL++L ++ NN+ + Sbjct: 186 VYLNLSGNDLTFIPDAISKLKK-LEELDVSSNSLESLPDSIGMLLNLRILNVNANNLTAL 244 Query: 473 P 475 P Sbjct: 245 P 245 Score = 29.1 bits (62), Expect = 2.7 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 4/59 (6%) Frame = +2 Query: 311 VDCSKKNLVSVPKIPEWA----EQLDLSHNKLNNVTNELNTLSNLKVLKLDXNNMNNIP 475 +D S NL S+P + E+L + NKL ++ + NLK L N ++ IP Sbjct: 257 LDASYNNLTSLPTNIGYGLQNLERLSIQLNKLRYFPGSISEMYNLKYLDAHMNEIHGIP 315 >At2g17440.1 68415.m02012 leucine-rich repeat family protein contains Pfam PF00560: Leucine Rich Repeats Length = 526 Score = 35.9 bits (79), Expect = 0.023 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 3/52 (5%) Frame = +2 Query: 329 NLVSVPKIP---EWAEQLDLSHNKLNNVTNELNTLSNLKVLKLDXNNMNNIP 475 NL S+P + E E+LD+S+N++ + TLSNL+VL+ + N + +P Sbjct: 427 NLRSLPGLIGNLEKLEELDMSNNQIRFLPYSFKTLSNLRVLQTEQNPLEELP 478 Score = 33.9 bits (74), Expect = 0.094 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = +2 Query: 365 EQLDLSHNKLNNVTNELNTLSNLKVLKLDXNNMNNIP 475 E+LDLS N L+ + + +L +LK L ++ NN+ IP Sbjct: 302 EELDLSSNSLSILPESIGSLVSLKKLDVETNNIEEIP 338 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +2 Query: 365 EQLDLSHNKLNNVTNELNTLSNLKVLKLDXNNMNNIP 475 E+L +N+L + + LS L++L + NN+ +P Sbjct: 348 EELRADYNRLKALPEAVGKLSTLEILTVRYNNIRQLP 384 >At1g35710.1 68414.m04439 leucine-rich repeat transmembrane protein kinase, putative similar to many predicted protein kinases Length = 1120 Score = 35.1 bits (77), Expect = 0.041 Identities = 17/48 (35%), Positives = 33/48 (68%), Gaps = 3/48 (6%) Frame = +2 Query: 338 SVPKIPEWAE--QLDLSHNKLN-NVTNELNTLSNLKVLKLDXNNMNNI 472 S+P++ + + QLDLSHN+L+ + ++L++L +L L L NN++ + Sbjct: 669 SIPRLSKLTQLTQLDLSHNQLDGEIPSQLSSLQSLDKLDLSHNNLSGL 716 >At5g58150.1 68418.m07278 leucine-rich repeat transmembrane protein kinase, putative Length = 785 Score = 33.5 bits (73), Expect = 0.12 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Frame = +2 Query: 302 HLYVDCSKKNLVSVPKIPEWA--EQLDLSHNKLNNVT-NELNTLSNLKVLKLDXNNM 463 HL + C++ P+I + + L+LS L N+ E++ LS+LKVL L NN+ Sbjct: 288 HLNLACNRFRAQEFPEIGKLSALHYLNLSRTNLTNIIPREISRLSHLKVLDLSSNNL 344 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = +2 Query: 365 EQLDLSHNKLNNVTNELNTLSNLKVLKLDXNNMN 466 + LDLS NK+ ++ ++L +LS L+ L L N ++ Sbjct: 93 QTLDLSGNKITSLPSDLWSLSLLESLNLSSNRIS 126 >At1g04210.1 68414.m00411 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 1112 Score = 33.1 bits (72), Expect = 0.16 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = +2 Query: 365 EQLDLSHNKLNNVTNELNTLSNLKVLKLDXNNM 463 E LDLS NK+ ++ NE+ LS+L LK+ N + Sbjct: 179 EYLDLSFNKIKSLPNEIGYLSSLTFLKVAHNRL 211 >At4g20940.1 68417.m03034 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to leucine-rich repeat receptor-like protein kinase INRPK1 [Ipomoea nil] gi|14495542|gb|AAB36558 Length = 977 Score = 32.3 bits (70), Expect = 0.29 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 299 LHLYVDCSKKNLVSVPKIPEWAEQLDLSHNKLN-NVTNELNTLSNLKVLKLDXNNMN 466 +HL + N+ +P LDLSHN+ + ++ +L+NL+VL L NN++ Sbjct: 464 IHLQNNGMTGNIGPLPSSGSRIRLLDLSHNRFDGDLPGVFGSLTNLQVLNLAANNLS 520 >At2g25470.1 68415.m03050 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to disease resistance protein [Lycopersicon esculentum] gi|3894383|gb|AAC78591 Length = 910 Score = 32.3 bits (70), Expect = 0.29 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = +2 Query: 365 EQLDLSHNKLNNVTNELNTLSNLKVLKLDXNNMN 466 E LDL NKLN EL L NL+VL L N+++ Sbjct: 176 ELLDLRANKLNGSMQELQNLINLEVLGLAQNHVD 209 Score = 30.7 bits (66), Expect = 0.88 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +2 Query: 365 EQLDLSHNKL-NNVTNELNTLSNLKVLKLDXNNMNNI 472 E LDLSHN L ++ L++L++L V + NN++ I Sbjct: 772 ESLDLSHNMLQGSIPQLLSSLTSLAVFDVSSNNLSGI 808 >At5g18360.1 68418.m02160 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 900 Score = 31.9 bits (69), Expect = 0.38 Identities = 22/71 (30%), Positives = 33/71 (46%) Frame = +2 Query: 239 LFLSSSTLGEIYFCPLECACLHLYVDCSKKNLVSVPKIPEWAEQLDLSHNKLNNVTNELN 418 L LS + + EI CL KNL + P +P+ E LDLS ++ V ++ Sbjct: 726 LSLSETAIEEIPTTVASWPCLAALDMSGCKNLKTFPCLPKTIEWLDLSRTEIEEVPLWID 785 Query: 419 TLSNLKVLKLD 451 LS L L ++ Sbjct: 786 KLSKLNKLLMN 796 >At3g11330.1 68416.m01378 leucine-rich repeat family protein Length = 499 Score = 31.9 bits (69), Expect = 0.38 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +2 Query: 368 QLDLSHNKLNNVTNELNTLSNLKVLKLDXNNMNNIP 475 +LD+S N L + + + LS LK+L + N + ++P Sbjct: 248 ELDVSTNSLETLPDSIGLLSKLKILNVSTNKLTSLP 283 >At1g66150.1 68414.m07508 leucine-rich repeat protein kinase, putative (TMK1) identical to protein kinase TMK1 gi|166888|gb|AAA32876, SP|P43298 Putative receptor protein kinase TMK1 precursor (EC 2.7.1.-) {Arabidopsis thaliana} Length = 942 Score = 31.5 bits (68), Expect = 0.50 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = +2 Query: 365 EQLDLSHNKLNNVTNELNTLSNLKVLKLDXNNMNNIP 475 E+L+L N ++ L+ L++L+VL L NN ++IP Sbjct: 91 ERLELQWNNISGPVPSLSGLASLQVLMLSNNNFDSIP 127 >At1g58190.1 68414.m06605 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 1784 Score = 31.5 bits (68), Expect = 0.50 Identities = 18/34 (52%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +2 Query: 365 EQLDLSHNKLNN-VTNELNTLSNLKVLKLDXNNM 463 E LD+S N +NN V +NT S+LK L L NNM Sbjct: 985 EILDISENGVNNTVLPFINTASSLKTLILHGNNM 1018 >At5g07910.1 68418.m00914 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 262 Score = 31.1 bits (67), Expect = 0.66 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +2 Query: 371 LDLSHNKLNNVTNELNTLSNLKVLKLDXNNMNNIP 475 LDL+HNK+ +V E++ L N++ L + N + +P Sbjct: 50 LDLTHNKIADVPGEISKLINMQRLLIADNLVERLP 84 >At2g26330.1 68415.m03159 leucine-rich repeat protein kinase, putative (ERECTA) identical to uncharacterized receptor protein kinase ERECTA [Arabidopsis thaliana] gi|1389566|dbj|BAA11869; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 976 Score = 31.1 bits (67), Expect = 0.66 Identities = 13/33 (39%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = +2 Query: 368 QLDLSHNKLNN-VTNELNTLSNLKVLKLDXNNM 463 ++DLS+N ++ + ELN L N+ +L+L+ NN+ Sbjct: 479 EIDLSNNDISGPIPEELNQLQNIILLRLENNNL 511 >At1g12970.1 68414.m01506 leucine-rich repeat family protein Length = 464 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +2 Query: 356 EWAEQLDLSHNKLNNVTNELNTLSNLKVLKLDXNNMNNIP 475 E E+LDLS N+L + + + L NL++L + N + +P Sbjct: 207 EKLEELDLSSNRLVFLPDSIGLLLNLRILNVTGNKLTLLP 246 >At3g15410.1 68416.m01955 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Hcr2-5D [Lycopersicon esculentum] gi|3894393|gb|AAC78596; identical to leucine-rich repeat protein [Arabidopsis thaliana] gi|2760084|emb|CAA76000 Length = 584 Score = 30.7 bits (66), Expect = 0.88 Identities = 11/35 (31%), Positives = 23/35 (65%) Frame = +2 Query: 371 LDLSHNKLNNVTNELNTLSNLKVLKLDXNNMNNIP 475 LDL+ N L ++ + +++LK L + NN++++P Sbjct: 504 LDLNQNSLQSIPKGIKNMTSLKHLDISNNNISSLP 538 Score = 29.9 bits (64), Expect = 1.5 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +2 Query: 368 QLDLSHNKLNNVTNELNTLSNLKVLKLDXNNMNNIP 475 +L LS +L+ V ++ LSNL +L L+ N++ +IP Sbjct: 480 ELYLSRIQLSEVPEDILNLSNLIILDLNQNSLQSIP 515 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/35 (31%), Positives = 23/35 (65%) Frame = +2 Query: 371 LDLSHNKLNNVTNELNTLSNLKVLKLDXNNMNNIP 475 L++SHNKL+ + + L+ +K L + N+++ +P Sbjct: 73 LNVSHNKLSQLPAAIGELTAMKSLDVSFNSISELP 107 >At5g05850.1 68418.m00643 leucine-rich repeat family protein contains Pfam PF00560: Leucine Rich Repeat domains; similar to (SP:Q9UQ13) Leucine-rich repeat protein SHOC-2 (Ras-binding protein Sur-8) (SP:Q9UQ13) {Homo sapiens} Length = 506 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 368 QLDLSHNKLNNVTNELNTLSNLKVLKLDXNNMNNIP 475 +LD+S N L + + + LS LK+L + N + +P Sbjct: 254 ELDVSTNFLETLPDSIGLLSKLKILNVSCNKLTTLP 289 >At4g29450.1 68417.m04204 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 863 Score = 30.3 bits (65), Expect = 1.2 Identities = 18/33 (54%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +2 Query: 365 EQLDLSHNKLN-NVTNELNTLSNLKVLKLDXNN 460 E LDLS+N L NV L L +LKVL L NN Sbjct: 440 ESLDLSNNDLQQNVPEFLADLKHLKVLNLKGNN 472 >At3g28040.1 68416.m03500 leucine-rich repeat transmembrane protein kinase, putative contains Pfam profiles: PF00560 leucine rich repeat, PF00069 eukaryotic protein kinase domain Length = 1016 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +2 Query: 371 LDLSHNKLNN-VTNELNTLSNLKVLKLDXNNMN 466 L LSHN L + L+ L LK+LKL+ N ++ Sbjct: 516 LSLSHNNLTGPIPKSLSNLQELKILKLEANKLS 548 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 30.3 bits (65), Expect = 1.2 Identities = 17/35 (48%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +2 Query: 365 EQLDLSHNKLNN-VTNELNTLSNLKVLKLDXNNMN 466 EQLDLSHNKL V ++ L NL K N N Sbjct: 300 EQLDLSHNKLTGFVVDKFCKLPNLDSFKFSYNFFN 334 >At1g56520.1 68414.m06499 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 897 Score = 29.9 bits (64), Expect = 1.5 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 305 LYVDCSKKNLVSVPK-IPEWAEQLDLSHNKLNNVTNELNTLSNLKVLKL 448 LY+ CS +NL + +P +LDLS+ + VT+ + L NL LKL Sbjct: 744 LYI-CSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKL 791 >At4g24490.1 68417.m03510 geranylgeranyl transferase alpha subunit-related / RAB geranylgeranyltransferase alpha subunit-related low similarity to SP|Q08602 [Rattus norvegicus] Length = 683 Score = 29.5 bits (63), Expect = 2.0 Identities = 20/58 (34%), Positives = 31/58 (53%) Frame = +2 Query: 296 CLHLYVDCSKKNLVSVPKIPEWAEQLDLSHNKLNNVTNELNTLSNLKVLKLDXNNMNN 469 CL L + S + SV K+ + + LDLSHN+L++ T L + L L L N + + Sbjct: 520 CLRLN-NLSLSRIASVEKLL-FVQMLDLSHNELHS-TEGLEAMQLLSCLNLSHNRIRS 574 >At5g49290.1 68418.m06100 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 888 Score = 29.1 bits (62), Expect = 2.7 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 6/60 (10%) Frame = +2 Query: 308 YVDCSKKNLVSVPKIPEWAEQLDLSHNKLNNVTNE------LNTLSNLKVLKLDXNNMNN 469 Y++ S NL + E LDLS+++LN + ++ L L NL++L N NN Sbjct: 77 YLEISLLNLSLLHPFEE-VRSLDLSNSRLNGLVDDVEGYKSLRRLRNLQILNFSSNEFNN 135 >At5g44700.1 68418.m05477 leucine-rich repeat transmembrane protein kinase, putative Length = 1252 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = +2 Query: 365 EQLDLSHNKL-NNVTNELNTLSNLKVLKLDXNNM 463 E LDLSHN+L V ++ + +L L L NN+ Sbjct: 796 ESLDLSHNQLVGEVPGQIGDMKSLGYLNLSYNNL 829 Score = 28.7 bits (61), Expect = 3.5 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 6/60 (10%) Frame = +2 Query: 305 LYVDCSKKNLVS-VP----KIPEWAEQLDLSHNKLN-NVTNELNTLSNLKVLKLDXNNMN 466 +++D S LV +P + E L L N L+ ++ ++L +L NLK LKL N +N Sbjct: 98 IHIDLSSNRLVGPIPTTLSNLSSSLESLHLFSNLLSGDIPSQLGSLVNLKSLKLGDNELN 157 >At2g17260.1 68415.m01993 glutamate receptor family protein (GLR3.1) (GLR2) identical to putative glutamate receptor GLR2 [Arabidopsis thaliana] gi|4185740|gb|AAD09174; plant glutamate receptor family, PMID:11379626 Length = 951 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -2 Query: 437 LLNSIAYSIHX*HYLVYYD*GPIAPPTQEFLAQTPNSSLNNRHINA 300 ++N + +H Y Y I PP + F ++ PN S +N+H+N+ Sbjct: 429 IINLVDDRVHQIGYWSNYSGLSIVPP-ESFYSKPPNRSSSNQHLNS 473 >At4g11170.1 68417.m01809 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1095 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/42 (30%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +2 Query: 353 PEWAEQLDLSHNKLNNVTNELNTLSNLKVLKLDXN-NMNNIP 475 PE +L++SH+KL + + + L NL+ + L+ + N+ +P Sbjct: 607 PECLVELNMSHSKLKKLWSGVQPLRNLRTMNLNSSRNLEILP 648 >At4g04220.1 68417.m00598 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-2A [Lycopersicon pimpinellifolium] gi|3894389|gb|AAC78594 Length = 811 Score = 28.7 bits (61), Expect = 3.5 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +2 Query: 356 EWAEQLDLSHNKL-NNVTNELNTLSNLKVLKLDXNNM 463 E E LDLSHN L + L+ LS L L L N + Sbjct: 690 EKVESLDLSHNNLTGEIPKTLSKLSELNTLDLRNNKL 726 >At4g29880.1 68417.m04252 leucine-rich repeat family protein contains leucine rich repeats, Pfam:PF00560 Length = 404 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +2 Query: 371 LDLSHNKLNNVTNELNTLSNLKVLKLDXNNMNNIP 475 LD+ N++ + N + LS LK+L + N + ++P Sbjct: 105 LDIHSNQIKALPNSIGCLSKLKILNVSGNFLVSLP 139 >At1g25570.1 68414.m03174 leucine-rich repeat protein-related contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains some similarity to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376 Length = 628 Score = 28.3 bits (60), Expect = 4.7 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +2 Query: 371 LDLSHNKLNNVTNELNTLSNLKVLKLDXNNM 463 LDLS+N+L E TLS+LK++ L+ N + Sbjct: 474 LDLSNNQLTGPIPESLTLSSLKLVLLNGNEL 504 >At5g56040.1 68418.m06992 leucine-rich repeat protein kinase, putative contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 953 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +2 Query: 371 LDLSHNKLNNVTNELNTLSNLKVLKLDXNNMN 466 LD+SHNKL N L L NL L + N + Sbjct: 629 LDVSHNKLAGNLNVLADLQNLVSLNISFNEFS 660 >At4g33290.1 68417.m04736 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 430 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +2 Query: 185 IASTKMGDSRLLLFITMSLFLSSSTL 262 + ST+ G+SR+++ I +LFL S+ L Sbjct: 49 VTSTREGESRVIMLIDYNLFLMSAVL 74 >At2g24230.1 68415.m02894 leucine-rich repeat transmembrane protein kinase, putative Length = 853 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = +2 Query: 365 EQLDLSHNKLNNVTNELNTLSNLKVLKLDXNNMN 466 + LDLS+NK++ + ++ +L+ LK L L N ++ Sbjct: 95 QSLDLSNNKISALPSDFWSLNTLKNLNLSFNKIS 128 >At1g64600.1 68414.m07322 expressed protein similar to Hypothetical 72.2 kDa protein in RPS27A-GPM1 intergenic region (Swiss-Prot:P36056) [Saccharomyces cerevisiae] Length = 537 Score = 27.9 bits (59), Expect = 6.2 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 196 RRCYRCLTVPAYIIQAVGKLIRE 128 ++C RCL VP + +A+ K +RE Sbjct: 18 KQCLRCLVVPVRLRRAIKKYLRE 40 >At5g49660.1 68418.m06147 leucine-rich repeat transmembrane protein kinase, putative contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 966 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 371 LDLSHNKLNNVTNELNTLSNLKVLK 445 L LSHN LN ++ LNT+ N +L+ Sbjct: 101 LRLSHNHLNKSSSFLNTIPNCSLLR 125 >At5g46330.1 68418.m05703 leucine-rich repeat transmembrane protein kinase, putative Length = 1173 Score = 27.5 bits (58), Expect = 8.2 Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +2 Query: 371 LDLSHNKLNN-VTNELNTLSNLKVLKLDXNNM 463 LDLS N L + L LS LK LKL NN+ Sbjct: 727 LDLSSNNLTGEIPESLANLSTLKHLKLASNNL 758 >At3g44400.1 68416.m04770 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1007 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 353 PEWAEQLDLSHNKLNNVTNELNTLSNLKVLKL-DXNNMNNIP 475 PE+ +LD+S +KL + L NLK + L D ++ +P Sbjct: 646 PEFLVELDMSSSKLRKLWEGTKQLRNLKWMDLSDSEDLKELP 687 >At1g56540.1 68414.m06502 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1096 Score = 27.5 bits (58), Expect = 8.2 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 1/72 (1%) Frame = +2 Query: 209 SRLLLFITMSLFLSSSTLGEIYFCPLECACLHLYVDCSKKNLVSVPKIPEWAEQLDLSH- 385 S LL L + +S + I C L + + K L S+PK+P + L SH Sbjct: 757 STLLPTSVTELHIDNSGIESITDCIKGLHNLRVLALSNCKKLTSLPKLPSSLKWLRASHC 816 Query: 386 NKLNNVTNELNT 421 L V+ LNT Sbjct: 817 ESLERVSEPLNT 828 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,731,949 Number of Sequences: 28952 Number of extensions: 252475 Number of successful extensions: 656 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 655 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -