BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_O04 (646 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 23 1.9 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 4.4 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 23.4 bits (48), Expect = 1.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 133 SVATSRGGGATLLDRRAPSLRPTLNGVEVILFFYLSRSH 17 +V +GGG+T S PTLN +E IL + + + Sbjct: 14 NVENLKGGGSTTPASPTLSTPPTLNLMEQILLAKIEKQN 52 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.2 bits (45), Expect = 4.4 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +3 Query: 108 PPPRLVATLTSSIPNRSHRGPGAVPFHQAQRALSATDKEM 227 PP RL L S I + R PG P + + + E+ Sbjct: 492 PPYRLNKPLMSLITSSEVRQPGKAPNYSVNWTIGQLEAEV 531 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,017 Number of Sequences: 438 Number of extensions: 3358 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19438227 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -