BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_N21 (381 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 29 0.014 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 29 0.014 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 29 0.014 DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 22 2.8 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 6.5 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 20 8.5 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 29.5 bits (63), Expect = 0.014 Identities = 15/61 (24%), Positives = 32/61 (52%) Frame = -1 Query: 192 QVKRNVPTATTVIAPSAIALAADVLLPCELEFLVIAKWQFICGNXKTTMSCDGTLCTGTR 13 ++ +N + +A A+A+ +++P + +L++ KW F K ++CD CT + Sbjct: 68 RIVQNFFIVSLAVADLAVAI---LVMPFNVAYLLLGKWIFGIHLCKLWLTCDVLCCTASI 124 Query: 12 L 10 L Sbjct: 125 L 125 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 29.5 bits (63), Expect = 0.014 Identities = 15/61 (24%), Positives = 32/61 (52%) Frame = -1 Query: 192 QVKRNVPTATTVIAPSAIALAADVLLPCELEFLVIAKWQFICGNXKTTMSCDGTLCTGTR 13 ++ +N + +A A+A+ +++P + +L++ KW F K ++CD CT + Sbjct: 68 RIVQNFFIVSLAVADLAVAI---LVMPFNVAYLLLGKWIFGIHLCKLWLTCDVLCCTASI 124 Query: 12 L 10 L Sbjct: 125 L 125 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 29.5 bits (63), Expect = 0.014 Identities = 15/61 (24%), Positives = 32/61 (52%) Frame = -1 Query: 192 QVKRNVPTATTVIAPSAIALAADVLLPCELEFLVIAKWQFICGNXKTTMSCDGTLCTGTR 13 ++ +N + +A A+A+ +++P + +L++ KW F K ++CD CT + Sbjct: 68 RIVQNFFIVSLAVADLAVAI---LVMPFNVAYLLLGKWIFGIHLCKLWLTCDVLCCTASI 124 Query: 12 L 10 L Sbjct: 125 L 125 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 21.8 bits (44), Expect = 2.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 125 SAANAIALGAMTVVAVGTFLFTWWQ 199 S N I LG++ + G FLF W+ Sbjct: 287 SQINGI-LGSLVAITGGCFLFRAWE 310 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 20.6 bits (41), Expect = 6.5 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -3 Query: 166 HNRHRA*CYSISSGCVAALRIRILGHR 86 H R + IS+GCV+ + RI +R Sbjct: 18 HQRCSRDWFRISAGCVSRISNRISRNR 44 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 20.2 bits (40), Expect = 8.5 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 165 WRSEHFSLLGG 197 W SEHF GG Sbjct: 333 WNSEHFFEYGG 343 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,185 Number of Sequences: 438 Number of extensions: 1841 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9300375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -