BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_N19 (390 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8GGP3 Cluster: Hybrid nonribosomal peptide synthetase ... 35 0.64 UniRef50_Q0RI59 Cluster: Non-ribosomal peptide synthetase; n=3; ... 33 1.5 UniRef50_Q556F5 Cluster: C2H2 type Zn finger-containing protein;... 33 2.0 UniRef50_A5IDG4 Cluster: Putative uncharacterized protein; n=4; ... 32 3.4 UniRef50_Q63MA9 Cluster: Family S58 unassigned peptidase; n=40; ... 31 6.0 UniRef50_Q1D8F1 Cluster: D-aminopeptidase; n=5; Bacteria|Rep: D-... 31 6.0 UniRef50_Q4Q1Y1 Cluster: Dynein heavy chain, putative; n=3; Leis... 31 6.0 UniRef50_A4I4B2 Cluster: Putative uncharacterized protein; n=3; ... 31 7.9 >UniRef50_Q8GGP3 Cluster: Hybrid nonribosomal peptide synthetase / polyketide synthase; n=12; root|Rep: Hybrid nonribosomal peptide synthetase / polyketide synthase - Streptomyces atroolivaceus Length = 4437 Score = 34.7 bits (76), Expect = 0.64 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +2 Query: 134 RDDGCGGRNISLYLVARKGGSPTARSSR 217 R+DGCG R + YLVA G +P+ R R Sbjct: 1416 REDGCGDRTLVAYLVALPGSAPSGRELR 1443 >UniRef50_Q0RI59 Cluster: Non-ribosomal peptide synthetase; n=3; cellular organisms|Rep: Non-ribosomal peptide synthetase - Frankia alni (strain ACN14a) Length = 1531 Score = 33.5 bits (73), Expect = 1.5 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 134 RDDGCGGRNISLYLVARKGGSPTARSSRRESAXIVXEH 247 R DG GGR ++ YLV G P A + R +A + +H Sbjct: 877 RTDGPGGRYLAAYLVLADGAQPDAAALRAHAAATLPDH 914 >UniRef50_Q556F5 Cluster: C2H2 type Zn finger-containing protein; n=1; Dictyostelium discoideum AX4|Rep: C2H2 type Zn finger-containing protein - Dictyostelium discoideum AX4 Length = 774 Score = 33.1 bits (72), Expect = 2.0 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -2 Query: 272 NKIIFPXXYVLXLXSPIRALSSVRWGNLPFLPPS-KEKCSDRHNRH 138 NK + P Y SP+ S+ GNL FL S ++ D HN H Sbjct: 689 NKSVLPSIYSSMQSSPLSTSSTTSKGNLSFLVSSNNDEDDDHHNHH 734 >UniRef50_A5IDG4 Cluster: Putative uncharacterized protein; n=4; Legionella pneumophila|Rep: Putative uncharacterized protein - Legionella pneumophila (strain Corby) Length = 461 Score = 32.3 bits (70), Expect = 3.4 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +3 Query: 3 TRAKCSITIIVVFXLPQINCHFAMTKNSNSQGSNTSAANAI 125 T C ++I++F P FA T N+N+QG + SA N++ Sbjct: 3 TLMTCIFSLIILFSPPFKPIVFAHTNNTNNQGLSASANNSV 43 >UniRef50_Q63MA9 Cluster: Family S58 unassigned peptidase; n=40; Bacteria|Rep: Family S58 unassigned peptidase - Burkholderia pseudomallei (Pseudomonas pseudomallei) Length = 376 Score = 31.5 bits (68), Expect = 6.0 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 202 GGGTSLSCHQVKRNVPTATTVIAPSA 125 GGGT + CH+ K + TA+ ++A +A Sbjct: 168 GGGTGMICHEFKGGIGTASRIVAEAA 193 >UniRef50_Q1D8F1 Cluster: D-aminopeptidase; n=5; Bacteria|Rep: D-aminopeptidase - Myxococcus xanthus (strain DK 1622) Length = 419 Score = 31.5 bits (68), Expect = 6.0 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 202 GGGTSLSCHQVKRNVPTATTVIAPSAIALAADVLLPC 92 GGGT + CH K + TA+ + S VLL C Sbjct: 198 GGGTGMVCHSFKAGIGTASRKLPESEGGYTVGVLLQC 234 >UniRef50_Q4Q1Y1 Cluster: Dynein heavy chain, putative; n=3; Leishmania|Rep: Dynein heavy chain, putative - Leishmania major Length = 4172 Score = 31.5 bits (68), Expect = 6.0 Identities = 16/58 (27%), Positives = 27/58 (46%) Frame = +3 Query: 15 CSITIIVVFXLPQINCHFAMTKNSNSQGSNTSAANAIALGAMTVVAVGTFLFTWWQER 188 C I+ ++ P +NC F + + + + S A I L T + V F+ +W Q R Sbjct: 1866 CLISGEIIAMTPYMNCWFEVEDLAVASPATVSRAGMIYLEPNTCIGVRNFILSWQQYR 1923 >UniRef50_A4I4B2 Cluster: Putative uncharacterized protein; n=3; Leishmania|Rep: Putative uncharacterized protein - Leishmania infantum Length = 578 Score = 31.1 bits (67), Expect = 7.9 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = -3 Query: 208 PCGGGTSLSCHQVKRNVPTATTVIAPSAIALAADVLLPCELEFLVIAKWQ 59 PCG L+CH P TV P A + V PC ++L ++W+ Sbjct: 323 PCGHLCWLTCHDETPCAPCKETVTVPCACG-SRHVSCPCFCQYLPESEWE 371 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 334,051,932 Number of Sequences: 1657284 Number of extensions: 5709608 Number of successful extensions: 14736 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 14397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14735 length of database: 575,637,011 effective HSP length: 91 effective length of database: 424,824,167 effective search space used: 16143318346 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -