BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_N19 (390 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17H9.03c |rdl1||RAD51D-like protein 1|Schizosaccharomyces po... 26 1.8 SPAPB1E7.07 |glt1||glutamate synthase Glt1 |Schizosaccharomyces ... 25 5.5 SPCC1259.12c |||Ran GTPase binding protein |Schizosaccharomyces ... 25 5.5 SPBC1773.06c |||alcohol dehydrogenase |Schizosaccharomyces pombe... 24 9.5 >SPAC17H9.03c |rdl1||RAD51D-like protein 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 230 Score = 26.2 bits (55), Expect = 1.8 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +2 Query: 53 NKLPFCDDQEF*FAGQQHIRC--*CYSTRRD 139 N PFC D + QQH +C C +R+D Sbjct: 148 NSWPFCLDHSYILEDQQHNKCLVHCNQSRKD 178 >SPAPB1E7.07 |glt1||glutamate synthase Glt1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2111 Score = 24.6 bits (51), Expect = 5.5 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = -3 Query: 166 RNVPTATTVIAPSAIALAADVLLPC 92 R+VP +++ P+A++ +L PC Sbjct: 176 RSVPCDNSILGPAALSREPTILQPC 200 >SPCC1259.12c |||Ran GTPase binding protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 486 Score = 24.6 bits (51), Expect = 5.5 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +2 Query: 32 CRFSVATNKLPFCDDQEF*FAGQQHIRC*CYST 130 CR S+ TN+LP C + + + G + C T Sbjct: 134 CRKSMQTNRLPGCTAESWGYHGNSGEKFNCSKT 166 >SPBC1773.06c |||alcohol dehydrogenase |Schizosaccharomyces pombe|chr 2|||Manual Length = 346 Score = 23.8 bits (49), Expect = 9.5 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = -3 Query: 199 GGTSLSCHQVKRNVPTATTVIAPSAIALAADVLLPC 92 GGT C Q +P V AP ++ LPC Sbjct: 111 GGTRDGCFQKYAVLPAHALVHAPKNLSFEEIATLPC 146 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,348,474 Number of Sequences: 5004 Number of extensions: 22686 Number of successful extensions: 43 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 128029482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -