BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_N16 (359 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0486 + 19577507-19577568,19578119-19578218,19581128-195812... 90 4e-19 11_06_0483 + 24118047-24118108,24118952-24119051,24119330-24119338 90 6e-19 03_06_0123 - 31821915-31822094,31822187-31822324,31822413-318228... 90 6e-19 >12_02_0486 + 19577507-19577568,19578119-19578218,19581128-19581214, 19581852-19581914 Length = 103 Score = 90.2 bits (214), Expect = 4e-19 Identities = 37/55 (67%), Positives = 41/55 (74%) Frame = +2 Query: 89 MGHANIWYSHPRRYGQGSRSCRSCSNRHGLIRKYGLNICRQCFXEYAHDIGFKKL 253 MGH+N+W SHP+ YG GSR CR C N HGLIRKYGL CRQCF A DIGF K+ Sbjct: 1 MGHSNVWNSHPKNYGPGSRVCRVCGNPHGLIRKYGLMCCRQCFRSNAKDIGFIKV 55 >11_06_0483 + 24118047-24118108,24118952-24119051,24119330-24119338 Length = 56 Score = 89.8 bits (213), Expect = 6e-19 Identities = 37/54 (68%), Positives = 40/54 (74%) Frame = +2 Query: 89 MGHANIWYSHPRRYGQGSRSCRSCSNRHGLIRKYGLNICRQCFXEYAHDIGFKK 250 MGH+N+W SHP+ YG GSR CR C N HGLIRKYGL CRQCF A DIGF K Sbjct: 1 MGHSNVWNSHPKNYGPGSRVCRVCGNPHGLIRKYGLMCCRQCFRSNAKDIGFIK 54 >03_06_0123 - 31821915-31822094,31822187-31822324,31822413-31822817, 31822897-31823212,31823305-31823543,31823800-31823903, 31823987-31824145,31824326-31824510,31825318-31825427, 31826900-31826947,31827047-31827241,31827354-31827422, 31829521-31829620,31829879-31829940 Length = 769 Score = 89.8 bits (213), Expect = 6e-19 Identities = 37/54 (68%), Positives = 40/54 (74%) Frame = +2 Query: 89 MGHANIWYSHPRRYGQGSRSCRSCSNRHGLIRKYGLNICRQCFXEYAHDIGFKK 250 MGH+N+W SHP+ YG GSR CR C N HGLIRKYGL CRQCF A DIGF K Sbjct: 1 MGHSNVWNSHPKNYGPGSRVCRVCGNPHGLIRKYGLMCCRQCFRSNAKDIGFIK 54 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,347,888 Number of Sequences: 37544 Number of extensions: 136420 Number of successful extensions: 272 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 271 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 272 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 554421256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -