BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_N15 (578 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q22WT2 Cluster: Putative uncharacterized protein; n=9; ... 33 4.9 UniRef50_Q54S42 Cluster: Putative uncharacterized protein; n=1; ... 33 6.4 >UniRef50_Q22WT2 Cluster: Putative uncharacterized protein; n=9; Eukaryota|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 2388 Score = 33.1 bits (72), Expect = 4.9 Identities = 18/47 (38%), Positives = 29/47 (61%) Frame = +1 Query: 10 KLFTNPTYLLITNQPNYYQLITNQIIKLFNIHKHCIKVLFNSTD*NL 150 +LFT IT++ N+Y+LITN +I +F + K + +FN T N+ Sbjct: 1308 ELFTVIQKDFITDRINFYKLITNNVIAIFFVDKFEL-FIFNGTKFNM 1353 >UniRef50_Q54S42 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 1459 Score = 32.7 bits (71), Expect = 6.4 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -1 Query: 458 FFYDHWLLDLIAIVRSIKIFNNILRFSFLNDL 363 + YDHWL+ + V SI +F L FSF N++ Sbjct: 906 YLYDHWLVLKVYNVISISLFEFDLNFSFSNEM 937 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 522,372,890 Number of Sequences: 1657284 Number of extensions: 9737444 Number of successful extensions: 18694 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18181 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18686 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 39987623712 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -