BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_N15 (578 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 vari... 26 0.31 DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 vari... 26 0.31 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 0.94 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 2.2 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 3.8 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 5.0 >DQ384991-1|ABD51779.1| 94|Apis mellifera allergen Api m 6 variant 2 precursor protein. Length = 94 Score = 25.8 bits (54), Expect = 0.31 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 230 FSGYRRFGGLGTRGRIRTN 174 F G+ FGGLG RG+ +N Sbjct: 22 FGGFGGFGGLGGRGKCPSN 40 >DQ384990-1|ABD51778.1| 92|Apis mellifera allergen Api m 6 variant 1 precursor protein. Length = 92 Score = 25.8 bits (54), Expect = 0.31 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 230 FSGYRRFGGLGTRGRIRTN 174 F G+ FGGLG RG+ +N Sbjct: 22 FGGFGGFGGLGGRGKCPSN 40 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 24.2 bits (50), Expect = 0.94 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +1 Query: 1 NQPKLFTNPTYLLITNQPNYYQLITNQIIKLFNIHK 108 +QP++F N ++++ Y ++ N+II F I+K Sbjct: 1525 SQPEVFVNGEKIVVSRNKAYQKVEENEII--FEIYK 1558 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 23.0 bits (47), Expect = 2.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 257 QETLPSLRLFSGYRRFGGLGTR 192 Q LPS S Y RFG L TR Sbjct: 260 QSLLPSQTGLSPYLRFGCLSTR 281 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = +1 Query: 382 NLRILLKIFIDLT 420 +LRILLK F+D+T Sbjct: 813 SLRILLKRFLDIT 825 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 73 TNQIIKLFNIHKHCIK 120 TN+I ++FN KH K Sbjct: 743 TNRISRIFNASKHSAK 758 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,165 Number of Sequences: 438 Number of extensions: 3086 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16748661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -