BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_N12 (652 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 26 1.2 AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. 25 1.6 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 24 3.6 AF185642-1|AAF15577.1| 103|Anopheles gambiae Toll-related prote... 24 3.6 AF185641-1|AAF15576.1| 116|Anopheles gambiae Toll protein. 24 3.6 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 8.4 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 23 8.4 AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 23 8.4 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 25.8 bits (54), Expect = 1.2 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 3/58 (5%) Frame = +2 Query: 272 TSRPTEVNTKPENDLSTLKPTTTIII---STLQPSSVPIASGLEEVNSTVEXRPLELE 436 T + TEV K +L+TLK T +++ LQ + + ++E S + EL+ Sbjct: 438 TRQKTEVEAKLTANLATLKDETKVLLEEKEKLQTELIELKRAVDESKSALSIAESELK 495 >AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. Length = 112 Score = 25.4 bits (53), Expect = 1.6 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 272 TSRPTEVNTKPENDLSTLKPTTTIIISTLQPSSVPIASG 388 T PT P +T+ PTTT ++ Q ++ +ASG Sbjct: 35 TVAPTTTTVAPTTT-TTVAPTTTTTVAPGQTTTTTVASG 72 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 24.2 bits (50), Expect = 3.6 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 399 LIPRSXNDP*NWKLFYRLQLWEP 467 L+P DP N+KL + ++ W P Sbjct: 915 LVPTLERDPMNFKLCWHVRDWTP 937 >AF185642-1|AAF15577.1| 103|Anopheles gambiae Toll-related protein protein. Length = 103 Score = 24.2 bits (50), Expect = 3.6 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 399 LIPRSXNDP*NWKLFYRLQLWEP 467 L+P DP N+KL + ++ W P Sbjct: 8 LVPTLERDPMNFKLCWHVRDWTP 30 >AF185641-1|AAF15576.1| 116|Anopheles gambiae Toll protein. Length = 116 Score = 24.2 bits (50), Expect = 3.6 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 399 LIPRSXNDP*NWKLFYRLQLWEP 467 L+P DP N+KL + ++ W P Sbjct: 16 LVPTLERDPMNFKLCWHVRDWTP 38 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 8.4 Identities = 17/63 (26%), Positives = 24/63 (38%) Frame = +2 Query: 62 SWEFSCLCLVHDCLSKPTTEHDPFRGRGIGSTIWGWITYPFTWWSSGEPELAPGSDQLLA 241 S E S L +HDC+S T P + G P WS+ +P +P + Sbjct: 195 SSEISTLRSLHDCISSFTLRLKP----SDLLFVIGDFNQPSISWSTADPSSSPAYSSITH 250 Query: 242 IGP 250 P Sbjct: 251 YEP 253 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.0 bits (47), Expect = 8.4 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -2 Query: 147 IPRPRNGSCSVVGLLRQSCTKHKQENSQEFITDH 46 + P C G S T +Q+N QEF+ D+ Sbjct: 33 VANPLKNRCLQFGTT--STTNTQQQNGQEFVDDY 64 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 23.0 bits (47), Expect = 8.4 Identities = 14/42 (33%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -3 Query: 146 SHDPETGHVQSSVCLDNRALSTSKR-TPKSLLQIMLRCRCEC 24 S DP ++ VC+DN S R T L M + EC Sbjct: 379 SSDPSFEEMRKVVCVDNYRPSVQNRWTSDPFLASMSKLMREC 420 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 625,326 Number of Sequences: 2352 Number of extensions: 13333 Number of successful extensions: 28 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -