BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_L21 (551 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondri... 66 2e-11 At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondri... 66 2e-11 At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial... 65 3e-11 At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondri... 63 1e-10 At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial... 62 3e-10 At5g56450.1 68418.m07046 mitochondrial substrate carrier family ... 53 1e-07 At3g51870.1 68416.m05688 mitochondrial substrate carrier family ... 47 7e-06 At4g26180.1 68417.m03768 mitochondrial substrate carrier family ... 46 2e-05 At4g01100.1 68417.m00148 mitochondrial substrate carrier family ... 46 2e-05 At1g14560.1 68414.m01731 mitochondrial substrate carrier family ... 45 3e-05 At5g51050.1 68418.m06328 mitochondrial substrate carrier family ... 44 7e-05 At5g01500.1 68418.m00064 mitochondrial substrate carrier family ... 43 1e-04 At5g61810.1 68418.m07756 mitochondrial substrate carrier family ... 42 2e-04 At3g55640.1 68416.m06182 mitochondrial substrate carrier family ... 42 4e-04 At5g07320.1 68418.m00836 mitochondrial substrate carrier family ... 41 5e-04 At1g78180.1 68414.m09110 mitochondrial substrate carrier family ... 40 8e-04 At3g53940.1 68416.m05959 mitochondrial substrate carrier family ... 39 0.002 At2g37890.1 68415.m04651 mitochondrial substrate carrier family ... 38 0.004 At3g48850.1 68416.m05335 mitochondrial phosphate transporter, pu... 37 0.010 At4g39460.1 68417.m05583 mitochondrial substrate carrier family ... 36 0.014 At1g14140.1 68414.m01671 mitochondrial substrate carrier family ... 36 0.014 At5g64970.1 68418.m08172 mitochondrial substrate carrier family ... 36 0.018 At1g25380.1 68414.m03150 mitochondrial substrate carrier family ... 33 0.096 At4g32400.1 68417.m04613 mitochondrial substrate carrier family ... 32 0.29 At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, p... 31 0.39 At4g03115.1 68417.m00424 mitochondrial substrate carrier family ... 31 0.51 At3g21390.1 68416.m02700 mitochondrial substrate carrier family ... 31 0.51 At5g48970.1 68418.m06059 mitochondrial substrate carrier family ... 30 0.89 At3g20240.1 68416.m02564 mitochondrial substrate carrier family ... 30 1.2 At2g35800.1 68415.m04396 mitochondrial substrate carrier family ... 29 1.6 At1g34065.1 68414.m04223 mitochondrial substrate carrier family ... 29 2.7 At5g66380.1 68418.m08370 mitochondrial substrate carrier family ... 28 3.6 At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to ... 28 3.6 At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to ... 28 3.6 At5g09470.1 68418.m01096 mitochondrial substrate carrier family ... 28 3.6 At1g74240.1 68414.m08598 mitochondrial substrate carrier family ... 28 3.6 At2g46320.1 68415.m05761 mitochondrial substrate carrier family ... 27 6.3 At5g41410.1 68418.m05031 homeodomain protein (BEL1) identical to... 27 8.3 At2g40150.1 68415.m04938 expressed protein 27 8.3 At2g30160.1 68415.m03670 mitochondrial substrate carrier family ... 27 8.3 >At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 65.7 bits (153), Expect = 2e-11 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 1/60 (1%) Frame = +3 Query: 171 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQG 347 FA DFL GG+SAAVSKTA APIERVKLL+Q Q + K + YKGI D F R K++G Sbjct: 80 FALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEG 139 Score = 61.3 bits (142), Expect = 4e-10 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +1 Query: 337 RSRGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 447 + G S WRGN ANVIRYFPTQALNFAFKD +K++F Sbjct: 136 KDEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLF 172 >At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondrial / ADP/ATP translocase 1 / adenine nucleotide translocator 1 (ANT1) identical to SWISS-PROT:P31167 ADP,ATP carrier protein 1 (Adenine nucleotide translocator 1) [Arabidopsis thaliana] Length = 381 Score = 65.7 bits (153), Expect = 2e-11 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 1/60 (1%) Frame = +3 Query: 171 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQG 347 FA DFL GG+SAAVSKTA APIERVKLL+Q Q + K + YKGI D F R K++G Sbjct: 80 FALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEG 139 Score = 61.3 bits (142), Expect = 4e-10 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +1 Query: 337 RSRGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 447 + G S WRGN ANVIRYFPTQALNFAFKD +K++F Sbjct: 136 KDEGFGSLWRGNTANVIRYFPTQALNFAFKDYFKRLF 172 >At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to mitochondrial ADP,ATP carrier protein SP:P12857 from [Zea mays] Length = 379 Score = 65.3 bits (152), Expect = 3e-11 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 1/60 (1%) Frame = +3 Query: 171 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQG 347 F DFL GG+SAAVSKTA APIERVKLL+Q Q + K + YKGI D F R K++G Sbjct: 79 FLIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGISDCFARTVKDEG 138 Score = 64.1 bits (149), Expect = 6e-11 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +1 Query: 337 RSRGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 447 + G+L+ WRGN ANVIRYFPTQALNFAFKD +K++F Sbjct: 135 KDEGMLALWRGNTANVIRYFPTQALNFAFKDYFKRLF 171 >At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondrial / ADP/ATP translocase 2 / adenine nucleotide translocator 2 (ANT2) identical to SWISS-PROT:P40941 ADP,ATP carrier protein 2, mitochondrial precursor (Adenine nucleotide translocator 2) [Arabidopsis thaliana] Length = 385 Score = 63.3 bits (147), Expect = 1e-10 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +1 Query: 337 RSRGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 447 R G+ S WRGN ANVIRYFPTQALNFAFKD +K++F Sbjct: 140 RDEGIGSLWRGNTANVIRYFPTQALNFAFKDYFKRLF 176 Score = 62.9 bits (146), Expect = 1e-10 Identities = 34/60 (56%), Positives = 42/60 (70%), Gaps = 1/60 (1%) Frame = +3 Query: 171 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQG 347 FA DF+ GG+SAAVSKTA APIERVKLL+Q Q + K + YKGI D F R +++G Sbjct: 84 FAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGRLTEPYKGIRDCFGRTIRDEG 143 >At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial, putative / ADP/ATP translocase, putative / adenine nucleotide translocator, putative similar to SWISS-PROT:Q09188 ADP,ATP carrier protein (ADP/ATP translocase) [Schizosaccharomyces pombe]; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 306 Score = 61.7 bits (143), Expect = 3e-10 Identities = 32/56 (57%), Positives = 39/56 (69%) Frame = +1 Query: 337 RSRGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGR*QEDAVLALLRW*SG 504 R G+LSFWRGN ANVIRYFPTQA NFAFK +K + LG ++D L+W +G Sbjct: 66 REEGVLSFWRGNQANVIRYFPTQASNFAFKGYFKNL-LGCSKEKD---GYLKWFAG 117 Score = 52.8 bits (121), Expect = 1e-07 Identities = 29/60 (48%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +3 Query: 171 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQG 347 F+ DF+ GG +A V+K+A APIERVKLLLQ Q + K + Y G+ + F RI +E+G Sbjct: 10 FSADFVMGGAAAIVAKSAAAPIERVKLLLQNQGEMIKTGHLIRPYTGLGNCFTRIYREEG 69 >At5g56450.1 68418.m07046 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 330 Score = 53.2 bits (122), Expect = 1e-07 Identities = 21/49 (42%), Positives = 33/49 (67%) Frame = +1 Query: 337 RSRGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGR*QEDAVLA 483 R G+LS WRGN ++V+RY+P+ ALNF+ KD Y+ + QE+ + + Sbjct: 91 REEGVLSLWRGNGSSVLRYYPSVALNFSLKDLYRSILRNSSSQENHIFS 139 Score = 51.6 bits (118), Expect = 3e-07 Identities = 29/65 (44%), Positives = 36/65 (55%), Gaps = 6/65 (9%) Frame = +3 Query: 171 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ------RYKGIVDAFVRI 332 F KD LAG + V T VAPIER KLLLQ Q + I D+ R+KG+ D R Sbjct: 30 FQKDLLAGAVMGGVVHTIVAPIERAKLLLQTQESNIAIVGDEGHAGKRRFKGMFDFIFRT 89 Query: 333 PKEQG 347 +E+G Sbjct: 90 VREEG 94 >At3g51870.1 68416.m05688 mitochondrial substrate carrier family protein peroxisomal Ca-dependent solute carrier - Oryctolagus cuniculus, EMBL:AF004161 Length = 381 Score = 47.2 bits (107), Expect = 7e-06 Identities = 30/94 (31%), Positives = 48/94 (51%) Frame = +3 Query: 135 SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIV 314 +N ++ LA A F AG ++ A +KT AP++R+KLL+Q + + ++ G + Sbjct: 75 NNPLAILALVPKDAAIFAAGALAGAAAKTVTAPLDRIKLLMQTHGIRLGQQSAKKAIGFI 134 Query: 315 DAFVRIPKEQGSPFILAW*LRQRHQVLPDPGAQL 416 +A I KE+G L Q +VLP QL Sbjct: 135 EAITLIAKEEGVKGYWKGNLPQVIRVLPYSAVQL 168 Score = 34.7 bits (76), Expect = 0.042 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 337 RSRGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLG 453 + G+ +W+GN VIR P A+ + YK +F G Sbjct: 142 KEEGVKGYWKGNLPQVIRVLPYSAVQLLAYESYKNLFKG 180 >At4g26180.1 68417.m03768 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 325 Score = 46.0 bits (104), Expect = 2e-05 Identities = 17/32 (53%), Positives = 27/32 (84%) Frame = +3 Query: 171 FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ 266 FAK+ +AGG++ ++KTAVAP+ER+K+L Q + Sbjct: 17 FAKELIAGGVTGGIAKTAVAPLERIKILFQTR 48 Score = 34.7 bits (76), Expect = 0.042 Identities = 23/91 (25%), Positives = 40/91 (43%), Gaps = 1/91 (1%) Frame = +3 Query: 180 DFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQR-YKGIVDAFVRIPKEQGSPF 356 D +AG + + P++ V+ L Q K I +Q Y+GIVD F R +E G+ Sbjct: 116 DLVAGSFAGGTAVLFTYPLDLVRTKLAYQTQVKAIPVEQIIYRGIVDCFSRTYRESGARG 175 Query: 357 ILAW*LRQRHQVLPDPGAQLRLQGQVQAGVP 449 + + + P G + +++ VP Sbjct: 176 LYRGVAPSLYGIFPYAGLKFYFYEEMKRHVP 206 Score = 33.9 bits (74), Expect = 0.073 Identities = 14/40 (35%), Positives = 26/40 (65%) Frame = +1 Query: 337 RSRGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGG 456 ++ GL+ F+RGN A+V R P AL++ ++Y++ + G Sbjct: 66 KTEGLMGFYRGNGASVARIVPYAALHYMAYEEYRRWIIFG 105 >At4g01100.1 68417.m00148 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 352 Score = 46.0 bits (104), Expect = 2e-05 Identities = 24/60 (40%), Positives = 36/60 (60%) Frame = +3 Query: 168 AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 347 + K AGG++ VS+TAVAP+ER+K+LLQVQ+ + +Y G V I + +G Sbjct: 37 SICKSLFAGGVAGGVSRTAVAPLERMKILLQVQN-----PHNIKYSGTVQGLKHIWRTEG 91 >At1g14560.1 68414.m01731 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 45.2 bits (102), Expect = 3e-05 Identities = 25/64 (39%), Positives = 40/64 (62%), Gaps = 2/64 (3%) Frame = +3 Query: 129 T*SNKMSNLADPV-AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRY 302 T S + +L D + AK +AGG + A++KTAVAP+ER+K+LLQ + + K + Q Sbjct: 8 TLSADVMSLVDTLPVLAKTLIAGGAAGAIAKTAVAPLERIKILLQTRTNDFKTLGVSQSL 67 Query: 303 KGIV 314 K ++ Sbjct: 68 KKVL 71 Score = 29.9 bits (64), Expect = 1.2 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 346 GLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 450 G L F++GN A+VIR P AL++ + Y+ L Sbjct: 75 GPLGFYKGNGASVIRIIPYAALHYMTYEVYRDWIL 109 >At5g51050.1 68418.m06328 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 487 Score = 44.0 bits (99), Expect = 7e-05 Identities = 18/34 (52%), Positives = 27/34 (79%) Frame = +3 Query: 183 FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQI 284 F+AGGI+ A S+TA AP++R+K+LLQ+Q +I Sbjct: 212 FIAGGIAGAASRTATAPLDRLKVLLQIQKTDARI 245 >At5g01500.1 68418.m00064 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 415 Score = 43.2 bits (97), Expect = 1e-04 Identities = 24/78 (30%), Positives = 40/78 (51%) Frame = +3 Query: 183 FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGSPFIL 362 F AG + A +K+ AP++R+KLL+Q V + ++ G ++A I KE+G Sbjct: 119 FFAGAFAGAAAKSVTAPLDRIKLLMQTHGVRAGQQSAKKAIGFIEAITLIGKEEGIKGYW 178 Query: 363 AW*LRQRHQVLPDPGAQL 416 L Q +++P QL Sbjct: 179 KGNLPQVIRIVPYSAVQL 196 Score = 34.3 bits (75), Expect = 0.055 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 337 RSRGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLG 453 + G+ +W+GN VIR P A+ + YK++F G Sbjct: 170 KEEGIKGYWKGNLPQVIRIVPYSAVQLFAYETYKKLFRG 208 >At5g61810.1 68418.m07756 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier, Oryctolagus cuniculus,GI:2352427; contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 478 Score = 42.3 bits (95), Expect = 2e-04 Identities = 19/34 (55%), Positives = 27/34 (79%) Frame = +3 Query: 174 AKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVS 275 +K LAGGI+ AVS+TA AP++R+K+ LQVQ + Sbjct: 205 SKLLLAGGIAGAVSRTATAPLDRLKVALQVQRTN 238 Score = 30.7 bits (66), Expect = 0.68 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +3 Query: 186 LAGGISAAVSKTAVAPIERVKLLLQ 260 LAGG++ AV++TA+ P++ VK LQ Sbjct: 300 LAGGLAGAVAQTAIYPMDLVKTRLQ 324 >At3g55640.1 68416.m06182 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 332 Score = 41.5 bits (93), Expect = 4e-04 Identities = 24/58 (41%), Positives = 32/58 (55%) Frame = +3 Query: 174 AKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 347 A LAGG++ A SKT AP+ R+ +L QVQ + AA R I+ RI E+G Sbjct: 35 ASQLLAGGLAGAFSKTCTAPLSRLTILFQVQGMHTNAAA-LRKPSILHEASRILNEEG 91 Score = 31.1 bits (67), Expect = 0.51 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 346 GLLSFWRGNFANVIRYFPTQALNFAFKDKYKQ 441 GL +FW+GN + P ++NF + YK+ Sbjct: 91 GLKAFWKGNLVTIAHRLPYSSVNFYAYEHYKK 122 >At5g07320.1 68418.m00836 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427 (mitochondrial carrier superfamily); contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 479 Score = 41.1 bits (92), Expect = 5e-04 Identities = 17/27 (62%), Positives = 25/27 (92%) Frame = +3 Query: 186 LAGGISAAVSKTAVAPIERVKLLLQVQ 266 LAGG++ AVS+TA AP++R+K++LQVQ Sbjct: 210 LAGGLAGAVSRTATAPLDRLKVVLQVQ 236 Score = 30.3 bits (65), Expect = 0.89 Identities = 18/48 (37%), Positives = 31/48 (64%) Frame = +3 Query: 186 LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVR 329 +AGG++ A+++TA+ P++ VK LQ VS+ A + +K D +VR Sbjct: 301 MAGGMAGALAQTAIYPMDLVKTRLQT-CVSEGGKAPKLWKLTKDIWVR 347 >At1g78180.1 68414.m09110 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 342 Score = 40.3 bits (90), Expect = 8e-04 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +1 Query: 340 SRGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL 450 ++GL FW+GN NV+R P +A+NF D Y++ L Sbjct: 95 TQGLTGFWKGNLLNVLRTAPFKAVNFCAYDTYRKQLL 131 Score = 31.9 bits (69), Expect = 0.29 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +3 Query: 177 KDFLAGGISAAVSKTAVAPIERVKL 251 K AG ++A VSKT +AP+ER+KL Sbjct: 50 KHLWAGAVAAMVSKTFLAPLERLKL 74 >At3g53940.1 68416.m05959 mitochondrial substrate carrier family protein Length = 365 Score = 39.1 bits (87), Expect = 0.002 Identities = 23/54 (42%), Positives = 31/54 (57%) Frame = +3 Query: 186 LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 347 LAGGI+ A SKT AP+ R+ +L Q+Q + + AA I RI KE+G Sbjct: 74 LAGGIAGAFSKTCTAPLARLTILFQIQGMQSE-AAILSSPNIWHEASRIVKEEG 126 Score = 31.5 bits (68), Expect = 0.39 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 337 RSRGLLSFWRGNFANVIRYFPTQALNFAFKDKYK 438 + G +FW+GN V P A+NF ++YK Sbjct: 123 KEEGFRAFWKGNLVTVAHRLPYGAVNFYAYEEYK 156 >At2g37890.1 68415.m04651 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 37.9 bits (84), Expect = 0.004 Identities = 17/41 (41%), Positives = 27/41 (65%) Frame = +3 Query: 177 KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQR 299 ++ LAGGI+ A+SKT AP+ R+ +L Q+Q + + A R Sbjct: 43 QNLLAGGIAGAISKTCTAPLARLTILFQLQGMQSEGAVLSR 83 Score = 33.1 bits (72), Expect = 0.13 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 346 GLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVF 447 G +FW+GN V+ P A+NF +KY F Sbjct: 98 GYRAFWKGNLVTVVHRIPYTAVNFYAYEKYNLFF 131 Score = 33.1 bits (72), Expect = 0.13 Identities = 22/74 (29%), Positives = 38/74 (51%) Frame = +3 Query: 186 LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGSPFILA 365 ++GG++ AVS TA P++ V+ +QV+ + A G+ F I K +G I Sbjct: 248 VSGGLAGAVSSTATYPLDLVRRRMQVEGAGGR--ARVYNTGLFGTFKHIFKSEGFKGIYR 305 Query: 366 W*LRQRHQVLPDPG 407 L + ++V+P G Sbjct: 306 GILPEYYKVVPGVG 319 >At3g48850.1 68416.m05335 mitochondrial phosphate transporter, putative similar to mitochondrial phosphate transporter GI:3318617 from [Arabidopsis thaliana] Length = 363 Score = 36.7 bits (81), Expect = 0.010 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 1/78 (1%) Frame = +3 Query: 138 NKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVD 317 N+ + P FA +AG +S ++ TA+ P++ +K +Q+ + +YK I Sbjct: 56 NEKVEMYSPAYFAACTVAGMLSCGITHTAITPLDVIKCNMQIDPL--------KYKNITS 107 Query: 318 AFVRIPKEQG-SPFILAW 368 AF KEQG F W Sbjct: 108 AFKTTIKEQGLKGFTRGW 125 >At4g39460.1 68417.m05583 mitochondrial substrate carrier family protein Length = 325 Score = 36.3 bits (80), Expect = 0.014 Identities = 23/70 (32%), Positives = 38/70 (54%) Frame = +3 Query: 153 LADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRI 332 L+DP ++ L G + A++ P++ +K L VQ +KQ Y+GIVD I Sbjct: 224 LSDP----ENALIGAFAGALTGAVTTPLDVIKTRLMVQGSAKQ------YQGIVDCVQTI 273 Query: 333 PKEQGSPFIL 362 +E+G+P +L Sbjct: 274 VREEGAPALL 283 Score = 31.9 bits (69), Expect = 0.29 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +3 Query: 183 FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGI 311 F+AGG + V +TA+ PI+ +K LQ +I Y G+ Sbjct: 58 FIAGGTAGVVVETALYPIDTIKTRLQAARGGGKIVLKGLYSGL 100 >At1g14140.1 68414.m01671 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 305 Score = 36.3 bits (80), Expect = 0.014 Identities = 17/67 (25%), Positives = 33/67 (49%) Frame = +3 Query: 147 SNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFV 326 +N ++ + A L GG S +++ +P + VK+ +Q RY G ++AF Sbjct: 106 TNNSESLPLATKALVGGFSGVIAQVVASPADLVKVRMQADGRLVSQGLKPRYSGPIEAFT 165 Query: 327 RIPKEQG 347 +I + +G Sbjct: 166 KILQSEG 172 >At5g64970.1 68418.m08172 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 428 Score = 35.9 bits (79), Expect = 0.018 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 340 SRGLLSFWRGNFANVIRYFPTQALNFAFKDKYK 438 + G+ FW+GN N++R P +++NF D Y+ Sbjct: 178 NEGIRGFWKGNLVNILRTAPFKSINFYAYDTYR 210 Score = 31.5 bits (68), Expect = 0.39 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +3 Query: 150 NLADPVAFAKDFLAGGISAAVSKTAVAPIERVKL 251 N A + K AG +A VS+T +AP+ER+KL Sbjct: 124 NGAGALNTTKHLWAGAFAAMVSRTCIAPLERMKL 157 >At1g25380.1 68414.m03150 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 363 Score = 33.5 bits (73), Expect = 0.096 Identities = 18/53 (33%), Positives = 30/53 (56%) Frame = +3 Query: 189 AGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 347 AG + A++ T V P++ +K LQV + + A+ QR I+ + I KE+G Sbjct: 23 AGATAGAIAATFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEG 75 Score = 28.7 bits (61), Expect = 2.7 Identities = 13/56 (23%), Positives = 28/56 (50%) Frame = +3 Query: 186 LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGSP 353 +A I+ ++ P E ++ LQ Q + A+ +Y G++D ++ + +G P Sbjct: 222 IASSIAKVIASILTYPHEVIRAKLQEQGQIRN--AETKYSGVIDCITKVFRSEGIP 275 >At4g32400.1 68417.m04613 mitochondrial substrate carrier family protein Length = 392 Score = 31.9 bits (69), Expect = 0.29 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Frame = +3 Query: 186 LAGGISAAVSKTAVA-PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 347 L G A VS+T + P+E VK L +Q YKGI DAF++I +E+G Sbjct: 208 LLAGACAGVSQTLLTYPLELVKTRLTIQRGV--------YKGIFDAFLKIIREEG 254 Score = 29.9 bits (64), Expect = 1.2 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +3 Query: 186 LAGGISAAVSKTAVAPIERVKLLLQV 263 L+G ++ AVS+T VAP+E ++ L V Sbjct: 115 LSGAVAGAVSRTVVAPLETIRTHLMV 140 >At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, putative / a bout de souffle (BOU) / CAC-like protein identical to SP|Q93XM7 Mitochondrial carnitine/acylcarnitine carrier-like protein (A BOUT DE SOUFFLE) (Carnitine/acylcarnitine translocase-like protein) (CAC-like protein) {Arabidopsis thaliana}; contains Pfam profile: PF00153 mitochondrial carrier protein Length = 300 Score = 31.5 bits (68), Expect = 0.39 Identities = 20/54 (37%), Positives = 29/54 (53%) Frame = +3 Query: 186 LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 347 +AGG++ A V P + VK +LQV + RY G +DAF +I K +G Sbjct: 218 MAGGVAGASFWGIVYPTDVVKSVLQVDDYK-----NPRYTGSMDAFRKILKSEG 266 >At4g03115.1 68417.m00424 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 341 Score = 31.1 bits (67), Expect = 0.51 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 1/70 (1%) Frame = +3 Query: 141 KMSNLADPVA-FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVD 317 K NL P + F GIS A++ P++ VK+ LQ+QHV ++ G+ Sbjct: 52 KPQNLIPPFSKVVSHFGISGISVALATGVTHPLDVVKVRLQMQHVGQR----GPLIGMTG 107 Query: 318 AFVRIPKEQG 347 F+++ K +G Sbjct: 108 IFLQLMKNEG 117 >At3g21390.1 68416.m02700 mitochondrial substrate carrier family protein Length = 335 Score = 31.1 bits (67), Expect = 0.51 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +1 Query: 337 RSRGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLG 453 R GL FWRGN ++ P ++ FA K K G Sbjct: 76 REEGLSGFWRGNVPALLMVVPYTSIQFAVLHKVKSFAAG 114 Score = 30.3 bits (65), Expect = 0.89 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = +3 Query: 180 DFLAGGISAAVSKTAVAPIERVKLLLQVQ 266 D AGG++ A+S+ +P++ +K+ QVQ Sbjct: 18 DASAGGVAGAISRMVTSPLDVIKIRFQVQ 46 >At5g48970.1 68418.m06059 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 339 Score = 30.3 bits (65), Expect = 0.89 Identities = 14/47 (29%), Positives = 19/47 (40%) Frame = +1 Query: 337 RSRGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGR*QEDAV 477 R G FWRGN ++ P ++ F K K G ED + Sbjct: 81 REEGFRGFWRGNVPALLMVMPYTSIQFTVLHKLKSFASGSTKTEDHI 127 >At3g20240.1 68416.m02564 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier proteins Length = 348 Score = 29.9 bits (64), Expect = 1.2 Identities = 12/37 (32%), Positives = 25/37 (67%) Frame = +3 Query: 174 AKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQI 284 A++FL+G ++ A++K +AP+E ++ + V S+ I Sbjct: 49 AREFLSGALAGAMTKAVLAPLETIRTRMIVGVGSRSI 85 Score = 28.3 bits (60), Expect = 3.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 337 RSRGLLSFWRGNFANVIRYFPTQAL 411 + +G W GN N+IR PTQA+ Sbjct: 94 QKQGWQGLWAGNEINMIRIIPTQAI 118 >At2g35800.1 68415.m04396 mitochondrial substrate carrier family protein contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 823 Score = 29.5 bits (63), Expect = 1.6 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 1/70 (1%) Frame = +3 Query: 69 VIPHPRVPQLPPRHIHLVKIT*SNKMSNLADPVA-FAKDFLAGGISAAVSKTAVAPIERV 245 ++P+ R+ Q PR+I T +A P K LAGG+++A+S + + PI+ + Sbjct: 507 LLPYERL-QDDPRNIWFEAATVVAVAPPVALPAGDVLKSALAGGLASALSTSLMHPIDTI 565 Query: 246 KLLLQVQHVS 275 K +Q +S Sbjct: 566 KTRVQASTLS 575 >At1g34065.1 68414.m04223 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 327 Score = 28.7 bits (61), Expect = 2.7 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = +3 Query: 186 LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGS 350 + G + AV+ P++ +K L VQ Q YKG+ D I +E+GS Sbjct: 237 MIGAFAGAVTGVLTTPLDVIKTRLMVQGSGTQ------YKGVSDCIKTIIREEGS 285 >At5g66380.1 68418.m08370 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 308 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +3 Query: 231 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 347 PI VK LQ+Q Q Q Y G++DAF I KE+G Sbjct: 126 PIWLVKTRLQLQTPLHQT---QPYSGLLDAFRTIVKEEG 161 >At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 272 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/67 (26%), Positives = 31/67 (46%) Frame = +3 Query: 147 SNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFV 326 S+ + + LA ++ A++ P + VK+ LQ + +RY G VDA+ Sbjct: 108 SDFIGDIPLYQKILAALLTGAIAIIVANPTDLVKVRLQSEG-KLPAGVPRRYAGAVDAYF 166 Query: 327 RIPKEQG 347 I K +G Sbjct: 167 TIVKLEG 173 >At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to uncoupling protein GI:4063007 from [Arabidopsis thaliana] Length = 305 Score = 28.3 bits (60), Expect = 3.6 Identities = 18/67 (26%), Positives = 31/67 (46%) Frame = +3 Query: 147 SNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFV 326 S+ + + LA ++ A++ P + VK+ LQ + +RY G VDA+ Sbjct: 108 SDFIGDIPLYQKILAALLTGAIAIIVANPTDLVKVRLQSEG-KLPAGVPRRYAGAVDAYF 166 Query: 327 RIPKEQG 347 I K +G Sbjct: 167 TIVKLEG 173 >At5g09470.1 68418.m01096 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 337 Score = 28.3 bits (60), Expect = 3.6 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +1 Query: 337 RSRGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGG 456 R G+ S WRG++ V R A A D K++ + G Sbjct: 201 RQEGVSSLWRGSWLTVNRAMIVTASQLATYDHVKEILVAG 240 >At1g74240.1 68414.m08598 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 364 Score = 28.3 bits (60), Expect = 3.6 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = +3 Query: 177 KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIV 314 ++FL GGI+ A + + P++ +K LQ Q + + A QR K I+ Sbjct: 34 REFLWGGIAGAFGEGMMHPVDTLKTRLQSQII---MNATQRQKSIL 76 Score = 28.3 bits (60), Expect = 3.6 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = +3 Query: 192 GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 347 GG++ +S P++ VK LQVQ + +YKG +DA +I +++G Sbjct: 258 GGLAGGLSAYLTTPLDVVKTRLQVQ------GSTIKYKGWLDAVGQIWRKEG 303 >At2g46320.1 68415.m05761 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 361 Score = 27.5 bits (58), Expect = 6.3 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +3 Query: 273 SKQIAADQRYKGIVDAFVRIPKEQG 347 S + +D +YKG +D F +I +++G Sbjct: 91 SASVCSDNQYKGTLDVFYKIIRQEG 115 >At5g41410.1 68418.m05031 homeodomain protein (BEL1) identical to cDNA homeobox protein (BEL1) GI:28202124 Length = 611 Score = 27.1 bits (57), Expect = 8.3 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = -1 Query: 542 RSTERWLRRHHRRPDYQRSNARTASSCQRPPRNTCLYLSL---KAKL 411 + E W HH D +A T+S PP ++ ++ L KAKL Sbjct: 234 KQQEEWDTSHHSNNDQHDQSATTSSKKHVPPLHSLEFMELQKRKAKL 280 >At2g40150.1 68415.m04938 expressed protein Length = 424 Score = 27.1 bits (57), Expect = 8.3 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = -2 Query: 250 SLTRSMGATAVLETAAEIPPARKSLANATGSARFDILFDY 131 SL R+ + V + IPP RKSL N TGS + DY Sbjct: 147 SLNRNQWESMVCLVQSVIPPGRKSL-NQTGSLTVFKIQDY 185 >At2g30160.1 68415.m03670 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 331 Score = 27.1 bits (57), Expect = 8.3 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +3 Query: 195 GISAAVSKTAV-APIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 347 G+ A +S AV P++ VK LQ+ + YKG+ D R+ +E+G Sbjct: 139 GVFATISSDAVFTPMDMVKQRLQI--------GNGTYKGVWDCIKRVTREEG 182 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,086,063 Number of Sequences: 28952 Number of extensions: 207262 Number of successful extensions: 700 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 693 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1043173136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -