BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_L19 (514 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18527| Best HMM Match : LSM (HMM E-Value=1.3) 51 6e-07 SB_45736| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_17758| Best HMM Match : Transformer (HMM E-Value=0.35) 40 0.002 SB_57336| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_36570| Best HMM Match : DUF385 (HMM E-Value=2.9) 29 3.0 SB_44575| Best HMM Match : DUF444 (HMM E-Value=0.84) 28 3.9 SB_57257| Best HMM Match : NUC153 (HMM E-Value=1.2e-15) 28 5.2 SB_53339| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 >SB_18527| Best HMM Match : LSM (HMM E-Value=1.3) Length = 198 Score = 50.8 bits (116), Expect = 6e-07 Identities = 34/87 (39%), Positives = 50/87 (57%), Gaps = 5/87 (5%) Frame = +1 Query: 76 SQYKQKMAYKGPPKVQKVMVQPINLIFRYLQNRSRV--QIWLYEN---VNLRIEGHIVGF 240 S+++ ++Y G P Q P ++ Y ++S V +IW + + R H GF Sbjct: 72 SEFEDSVSYGGRPTSQV----PGPVLSAYWSDQSAVASRIWHSQRQYKCHNRATTH--GF 125 Query: 241 DEYMNIVLDEAEXVHMKSKNRKQIGRI 321 DEYMN+VLDEAE VH+K+K RK + RI Sbjct: 126 DEYMNLVLDEAEEVHLKTKTRKPLVRI 152 >SB_45736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 353 Score = 42.7 bits (96), Expect = 2e-04 Identities = 15/59 (25%), Positives = 39/59 (66%), Gaps = 2/59 (3%) Frame = +1 Query: 115 KVQKVMVQPINLIFRYLQNRSRVQIWL--YENVNLRIEGHIVGFDEYMNIVLDEAEXVH 285 K+Q V P+++++R ++ R ++++W Y+ + + G+++ FD++MN+ L + + V+ Sbjct: 143 KMQACSVGPMSILYRCVEERLKLRVWTRRYKGLRSVLSGYLIAFDKHMNLALMDVDEVY 201 >SB_17758| Best HMM Match : Transformer (HMM E-Value=0.35) Length = 974 Score = 39.5 bits (88), Expect = 0.002 Identities = 13/53 (24%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = +1 Query: 133 VQPINLIFRYLQNRSRVQIWL--YENVNLRIEGHIVGFDEYMNIVLDEAEXVH 285 V P+++++R ++ R ++++W Y+ + + G+++ FD++MN+ L + + V+ Sbjct: 4 VGPMSILYRCVEERLKLRVWTRRYKGLRSVLSGYLIAFDKHMNLALMDVDEVY 56 >SB_57336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 53 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +3 Query: 321 NDEGRQHNTHTEREPQRVSVKLGYKFAKSEVIPSK 425 +DEG Q + HT EP R+ ++ G K + + +K Sbjct: 12 DDEGDQDHEHTRVEPVRLRLRYGIKASSDHTLATK 46 >SB_36570| Best HMM Match : DUF385 (HMM E-Value=2.9) Length = 299 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -1 Query: 292 ISYGLXQLRREQYSCIHQNPRCVLQSSDSRFH 197 I YG L RE C+ NP+ VL SD H Sbjct: 159 IIYGRGTLVREGLVCVRSNPQAVLVVSDGSNH 190 >SB_44575| Best HMM Match : DUF444 (HMM E-Value=0.84) Length = 451 Score = 28.3 bits (60), Expect = 3.9 Identities = 9/31 (29%), Positives = 20/31 (64%) Frame = +3 Query: 294 EKQKTNRKNNDEGRQHNTHTEREPQRVSVKL 386 E +K+ +KN ++ NT +REP+++ ++ Sbjct: 46 ENEKSKKKNEKRKQRKNTDRKREPKQIKTRI 76 >SB_57257| Best HMM Match : NUC153 (HMM E-Value=1.2e-15) Length = 392 Score = 27.9 bits (59), Expect = 5.2 Identities = 14/52 (26%), Positives = 29/52 (55%) Frame = +3 Query: 279 SPYEIEKQKTNRKNNDEGRQHNTHTEREPQRVSVKLGYKFAKSEVIPSK*QF 434 S ++ ++ + ++DE + HT RE QR +K K + +++P+K +F Sbjct: 236 SQFDEVEEPEGKPSDDESSSDDEHTWREEQRKQLKT--KKKEKQMVPNKLKF 285 >SB_53339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 894 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +3 Query: 312 RKNNDEGRQHNTHTEREPQRVSVKLGYKFAKSEVIPSK 425 RK D+GR H E+E + + KL Y+ ++E + ++ Sbjct: 549 RKERDDGRFHIQKLEKERETLHSKLLYQQMRAETLENE 586 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,680,443 Number of Sequences: 59808 Number of extensions: 293748 Number of successful extensions: 800 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 800 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -