SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fe100P03_F_L18
         (643 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulati...    22   4.9  
AY531877-1|AAT08872.1|  247|Tribolium castaneum ORF1p protein.         22   4.9  
EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetyla...    21   8.6  

>DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulation
           protein.
          Length = 947

 Score = 21.8 bits (44), Expect = 4.9
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +2

Query: 485 VHLDKNQQTTIEHKVDTFQFCIQEANGTRSDLRVPRTL 598
           V +   ++T +E    TF F    ANGT + L  P+ L
Sbjct: 456 VDVSTKRRTELEDLTPTFDFTNGWANGTLAKLS-PKVL 492


>AY531877-1|AAT08872.1|  247|Tribolium castaneum ORF1p protein.
          Length = 247

 Score = 21.8 bits (44), Expect = 4.9
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +2

Query: 542 FCIQEANGTRSDL 580
           FC+QE  GT S L
Sbjct: 97  FCLQEEGGTTSQL 109


>EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetylase
           1 protein.
          Length = 534

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = -3

Query: 383 NVLERGLFC 357
           N +ERGLFC
Sbjct: 128 NCIERGLFC 136


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 142,313
Number of Sequences: 336
Number of extensions: 2951
Number of successful extensions: 9
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16448590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -