BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_L18 (643 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 4.9 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 22 4.9 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 8.6 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.8 bits (44), Expect = 4.9 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 485 VHLDKNQQTTIEHKVDTFQFCIQEANGTRSDLRVPRTL 598 V + ++T +E TF F ANGT + L P+ L Sbjct: 456 VDVSTKRRTELEDLTPTFDFTNGWANGTLAKLS-PKVL 492 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 21.8 bits (44), Expect = 4.9 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 542 FCIQEANGTRSDL 580 FC+QE GT S L Sbjct: 97 FCLQEEGGTTSQL 109 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.0 bits (42), Expect = 8.6 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -3 Query: 383 NVLERGLFC 357 N +ERGLFC Sbjct: 128 NCIERGLFC 136 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,313 Number of Sequences: 336 Number of extensions: 2951 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -