Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fe100P03_F_L17
         (655 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g21710.1 68417.m03144 DNA-directed RNA polymerase II 135 kDa ...    27   8.2  

>At4g21710.1 68417.m03144 DNA-directed RNA polymerase II 135 kDa
           polypeptide / RNA polymerase II subunit 2 (RPB135)
           (RPB2) (RP140) identical to SP|P38420 DNA-directed RNA
           polymerase II 135 kDa polypeptide (EC 2.7.7.6) (RNA
           polymerase II subunit 2) {Arabidopsis thaliana}
          Length = 1188

 Score = 27.5 bits (58), Expect = 8.2
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = -2

Query: 219 NNLXVIGCRLGFLNGDSVSMSQSELKSSGFLNTLF 115
           N +  I C  G+   DSV M+QS +   GF  +LF
Sbjct: 785 NAIVAISCYSGYNQEDSVIMNQSSI-DRGFFRSLF 818


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,434,040
Number of Sequences: 28952
Number of extensions: 226346
Number of successful extensions: 430
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 424
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 430
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1363910256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)