BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_L14 (655 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC23G7.09 |matmc_2|matmc|mating-type m-specific polypeptide mc... 36 0.005 SPBC1711.02 |matmc_1|matmc|mating-type m-specific polypeptide mc... 36 0.005 SPAC57A10.09c |||High-mobility group non-histone chromatin prote... 35 0.012 SPBC28F2.11 |||INO80 complex subunit |Schizosaccharomyces pombe|... 33 0.048 SPCC330.09 |||rRNA processing protein Enp2 |Schizosaccharomyces ... 27 2.4 SPBC32C12.02 |ste11|aff1, stex|transcription factor Ste11|Schizo... 26 5.5 SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces po... 25 7.2 SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces... 25 7.2 >SPBC23G7.09 |matmc_2|matmc|mating-type m-specific polypeptide mc|Schizosaccharomyces pombe|chr 2|||Manual Length = 181 Score = 35.9 bits (79), Expect = 0.005 Identities = 12/44 (27%), Positives = 27/44 (61%) Frame = +3 Query: 105 TDKPKRPMSAYLLWLNSARSKIKDDNPXLKVTEIAKKAGEIWRS 236 T++ RP +A++L+ + + NP + ++++K GE+WR+ Sbjct: 100 TERTPRPPNAFILYRKEKHATLLKSNPSINNSQVSKLVGEMWRN 143 >SPBC1711.02 |matmc_1|matmc|mating-type m-specific polypeptide mc|Schizosaccharomyces pombe|chr 2|||Manual Length = 181 Score = 35.9 bits (79), Expect = 0.005 Identities = 12/44 (27%), Positives = 27/44 (61%) Frame = +3 Query: 105 TDKPKRPMSAYLLWLNSARSKIKDDNPXLKVTEIAKKAGEIWRS 236 T++ RP +A++L+ + + NP + ++++K GE+WR+ Sbjct: 100 TERTPRPPNAFILYRKEKHATLLKSNPSINNSQVSKLVGEMWRN 143 >SPAC57A10.09c |||High-mobility group non-histone chromatin protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 108 Score = 34.7 bits (76), Expect = 0.012 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +3 Query: 99 KMTDKPKRPMSAYLLWLNSARSKIKDDNPXLKVTEIAKKAGEIWRSM 239 K + PKR MSA++ + R K+K DNP ++ G+ W+ + Sbjct: 11 KDPNTPKRNMSAFMFFSIENREKMKTDNPDATFGQLGSLLGKRWKEL 57 >SPBC28F2.11 |||INO80 complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 310 Score = 32.7 bits (71), Expect = 0.048 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 4/74 (5%) Frame = +3 Query: 111 KPKRPMSAYLLWLNSARSKIKDD--NPXLKVTEIAKKAGEIWRSMY--DKSEWXXXXXXX 278 +PKRP SAY L+ + RS+IK+ V E+ K E W S+ D+ + Sbjct: 116 QPKRPPSAYNLFQKNQRSEIKESLGEKSNDVKEVNKAMHEKWGSLSEDDRKTYEEEASKL 175 Query: 279 XXQYIVDLESFNAN 320 Y ++ ++NA+ Sbjct: 176 REAYEEEMAAYNAS 189 >SPCC330.09 |||rRNA processing protein Enp2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 634 Score = 27.1 bits (57), Expect = 2.4 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 Query: 338 EKKENPKTREESETGAKNKESETGRR 415 +KK P R+E T K K+ GRR Sbjct: 599 KKKSKPVNRDEDSTSGKKKQVTQGRR 624 >SPBC32C12.02 |ste11|aff1, stex|transcription factor Ste11|Schizosaccharomyces pombe|chr 2|||Manual Length = 468 Score = 25.8 bits (54), Expect = 5.5 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = -2 Query: 603 ELSNKKVYYLNLSNKSQKEKKHSFHGPEFKMINSKTLKLKYKFKEI 466 E + K YY +LS + + +KH PE+K K ++ + K++ Sbjct: 53 ESAQVKKYYSDLS--ALERQKHMLENPEYKYTPKKRSTVRRRHKKV 96 >SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces pombe|chr 3|||Manual Length = 2812 Score = 25.4 bits (53), Expect = 7.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 519 ILDHEMNVFFLSGFCYLDLNNTLFCSITHNK 611 IL ++ GFCYL L +F SI+ N+ Sbjct: 1063 ILSIKIEKSLYKGFCYLYLTLKVFLSISSNR 1093 >SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 3699 Score = 25.4 bits (53), Expect = 7.2 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -1 Query: 184 GLSSFIFDLALFNHNKYADIGLFGLSVILNPLNMYF 77 GL + +L+ +HNK + GL GLS +L L YF Sbjct: 1442 GLRPILMNLS--DHNKLSVNGLEGLSRLLRLLTNYF 1475 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,015,838 Number of Sequences: 5004 Number of extensions: 33279 Number of successful extensions: 113 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -