BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_L08 (652 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 26 0.27 L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 23 2.6 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 4.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 4.5 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 7.8 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 7.8 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 26.2 bits (55), Expect = 0.27 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +3 Query: 294 FPIQYPDIWQMYKKAEASFWTVEEVDLSXD 383 FP Q P W++ K AE + + V E DLS D Sbjct: 217 FPYQPPFAWKILKAAEEAGFGVSE-DLSGD 245 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +2 Query: 383 FIXLGNLKR**ETFHQACPCFLCG 454 ++ LG LK T C C LCG Sbjct: 26 YVSLGALKMHIRTHTLPCKCHLCG 49 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 285 SAAGSPAAEVPFVGRTLRN 229 +A G P +VP V R LRN Sbjct: 66 TADGHPVNDVPGVRRVLRN 84 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 285 SAAGSPAAEVPFVGRTLRN 229 +A G P +VP V R LRN Sbjct: 66 TADGHPVNDVPGVRRVLRN 84 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 245 PTKGTSAAGEPA 280 P KG +AAG+P+ Sbjct: 530 PAKGAAAAGQPS 541 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 345 SFWTVEEVDLSXDL 386 +FWT +VDLS L Sbjct: 450 TFWTKSDVDLSRGL 463 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,199 Number of Sequences: 438 Number of extensions: 2976 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -