BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_K05 (643 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016445-9|AAC69061.1| 156|Caenorhabditis elegans Hypothetical ... 30 1.2 U02289-1|AAA18934.1| 1439|Caenorhabditis elegans GTPase-activati... 28 4.9 L16687-1|AAK71357.2| 1317|Caenorhabditis elegans Hypothetical pr... 28 4.9 >AF016445-9|AAC69061.1| 156|Caenorhabditis elegans Hypothetical protein T05B4.13 protein. Length = 156 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = -1 Query: 328 NSMSRRTCLDSPTFNTATGSFTASCSDMASTCITFNS 218 N+ +RTC P+ TA+ S TAS S STC ++N+ Sbjct: 87 NTYCQRTCGRCPSSTTASSSSTASSS---STCTSYNA 120 >U02289-1|AAA18934.1| 1439|Caenorhabditis elegans GTPase-activating protein protein. Length = 1439 Score = 28.3 bits (60), Expect = 4.9 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +1 Query: 34 NVLLKISTKLVKSS*RTSFSMVSPFHHHISQRHGIQRQKQNTHAATSSS 180 N ++ V SS +T + S FHHH SQ G R +N A T+++ Sbjct: 690 NKKMETDPSTVPSSSQTMATTSSSFHHHSSQA-GPSRDIENGEAPTATA 737 >L16687-1|AAK71357.2| 1317|Caenorhabditis elegans Hypothetical protein C04D8.1 protein. Length = 1317 Score = 28.3 bits (60), Expect = 4.9 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +1 Query: 34 NVLLKISTKLVKSS*RTSFSMVSPFHHHISQRHGIQRQKQNTHAATSSS 180 N ++ V SS +T + S FHHH SQ G R +N A T+++ Sbjct: 568 NKKMETDPSTVPSSSQTMATTSSSFHHHSSQA-GPSRDIENGEAPTATA 615 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,880,303 Number of Sequences: 27780 Number of extensions: 233690 Number of successful extensions: 611 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 593 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 609 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1427403330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -