BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_K04 (624 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 25 1.5 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 25 2.0 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 6.0 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 23 7.9 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 25.4 bits (53), Expect = 1.5 Identities = 15/55 (27%), Positives = 22/55 (40%), Gaps = 3/55 (5%) Frame = -1 Query: 327 PEAGSSPESRCASAGSNQTSRYRRIKTXGSSQWRRLQ---QTEAQSFHWCRRHGD 172 P S C + R R++ Q R+ QT +Q+ HW + HGD Sbjct: 182 PRVLESAAKFCEVLKGREMQRQFRLEQEQLQQMRKQSVDTQTLSQANHWLKSHGD 236 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 25.0 bits (52), Expect = 2.0 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 519 KHTETCEKNPLPTKDVIEQEKS 584 K+T TCE LP +DV+ + S Sbjct: 477 KNTTTCEDYALPYQDVVPSDPS 498 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.4 bits (48), Expect = 6.0 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = -2 Query: 533 RFRVLQLSGIEVLDAVQEFVLFLXRFDS 450 R ++ L +E+++ +Q+F F FD+ Sbjct: 7 RVKMFNLKRVEIMNTLQDFEEFTKSFDA 34 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 23.0 bits (47), Expect = 7.9 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = -1 Query: 366 GSGGLSPLRQHLCPEAGSSPESRCASAGSNQTSRY 262 G G SP+ H+ P + S S SN S Y Sbjct: 197 GGGPNSPISSHMGPNSPMSSVSSPGPISSNPQSPY 231 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 586,906 Number of Sequences: 2352 Number of extensions: 11353 Number of successful extensions: 34 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -