BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_K01 (656 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0629 + 35187318-35187320,35187424-35187534,35188089-351881... 30 1.9 02_01_0232 + 1543597-1543800,1544189-1544377,1544695-1544859,154... 29 3.3 >03_06_0629 + 35187318-35187320,35187424-35187534,35188089-35188191, 35188357-35188416,35188502-35188661,35188755-35188872 Length = 184 Score = 29.9 bits (64), Expect = 1.9 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = -3 Query: 501 YNYWLLLVSIL*MYEIIDLLGPIXCYFGLFL 409 Y W ++ ++L + ++ L GP+ CY G++L Sbjct: 66 YLRWHVITALLKLTSVVTLEGPLPCYAGVYL 96 >02_01_0232 + 1543597-1543800,1544189-1544377,1544695-1544859, 1545199-1545459,1546059-1546271,1546365-1546587, 1547974-1548149 Length = 476 Score = 29.1 bits (62), Expect = 3.3 Identities = 10/33 (30%), Positives = 21/33 (63%), Gaps = 4/33 (12%) Frame = +3 Query: 57 ILKHIHSFMASSTIGF----RVLKHPTLYWWHR 143 ++ H+ ++ +T+ F V+K P++YWW+R Sbjct: 250 LIDHVDQVLSLATLAFDGVETVVKIPSIYWWYR 282 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,412,865 Number of Sequences: 37544 Number of extensions: 215880 Number of successful extensions: 386 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 386 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -